PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_27801_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 163aa MW: 17655.3 Da PI: 10.2239 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 195.5 | 7.7e-61 | 24 | 160 | 1 | 137 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 svyk+kaa++v++v+ptf++ dsg lk+kr+G +ll++ +a++erky+Wek+q+fals+tev++l+ +++++s+effhdp++ +sn+G+vrk+l+ Neem_27801_f_1 24 SVYKGKAAFSVDPVLPTFTKTDSGFLKVKRKGVILLTFWPAIGERKYNWEKRQNFALSPTEVGSLITMGPNDSSEFFHDPGMLSSNAGQVRKSLS 118 79********************************************************************************************* PP Whirly 96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137 ++ l+dG G+f++l+v+ns++k+ e+++vPv+ aefav++++ Neem_27801_f_1 119 IKALADGNGYFISLNVSNSILKTSERLVVPVTAAEFAVMKTA 160 ****************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 6.3E-64 | 12 | 162 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 1.8E-54 | 17 | 162 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 9.0E-58 | 25 | 159 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MSQAGMSTTS QDVSAKSRVF APYSVYKGKA AFSVDPVLPT FTKTDSGFLK VKRKGVILLT 60 FWPAIGERKY NWEKRQNFAL SPTEVGSLIT MGPNDSSEFF HDPGMLSSNA GQVRKSLSIK 120 ALADGNGYFI SLNVSNSILK TSERLVVPVT AAEFAVMKTA CSV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4kop_A | 3e-76 | 18 | 162 | 10 | 154 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_B | 3e-76 | 18 | 162 | 10 | 154 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_C | 3e-76 | 18 | 162 | 10 | 154 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_D | 3e-76 | 18 | 162 | 10 | 154 | Single-stranded DNA-binding protein WHY2, mitochondrial |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006478304.1 | 5e-90 | single-stranded DNA-binding protein WHY2, mitochondrial isoform X1 | ||||
Swissprot | D9J034 | 1e-76 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A067E875 | 4e-90 | A0A067E875_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A067E8I3 | 7e-90 | A0A067E8I3_CITSI; Uncharacterized protein | ||||
STRING | XP_006478304.1 | 2e-89 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12358 | 27 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 1e-77 | WHIRLY 2 |