PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_27542_f_3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 190aa MW: 21855.8 Da PI: 7.9199 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.5 | 3.1e-18 | 52 | 98 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd++l av+++G ++Wk Ia++++ Rt qc +rwqk+l Neem_27542_f_3 52 KGGWTEEEDKILEFAVEKFGARNWKNIAECVP-DRTSVQCLHRWQKVL 98 688*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 62.3 | 9.8e-20 | 104 | 150 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+l++++v + G++ W+ Ia++++ gR +kqc++rw+++l Neem_27542_f_3 104 KGPWTKEEDDLIIELVGKQGNKKWSEIAKHLP-GRIGKQCRERWHNHL 150 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 37.5 | 5.4e-12 | 157 | 188 | 2 | 35 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgR 35 +WT+eE++ l++a++ +G++ W+ Ia+ ++ gR Neem_27542_f_3 157 TAWTKEEELTLIKAHEIYGNK-WAEIAKLLP-GR 188 68*******************.*********.98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.344 | 47 | 98 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-15 | 51 | 100 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-16 | 52 | 98 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.09E-17 | 53 | 108 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.1E-22 | 54 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.64E-13 | 55 | 98 | No hit | No description |
PROSITE profile | PS51294 | 31.688 | 99 | 154 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.99E-28 | 101 | 188 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.8E-18 | 103 | 152 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.60E-14 | 106 | 150 | No hit | No description |
Pfam | PF13921 | 7.0E-20 | 107 | 165 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.6E-28 | 107 | 153 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.2E-16 | 154 | 188 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.477 | 155 | 190 | IPR017930 | Myb domain |
SMART | SM00717 | 0.0087 | 155 | 188 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.62E-7 | 158 | 188 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MVEATTCHND ENNEEGLVSL IPSVSDVSSH KAEAKRDYIQ GRMTGPTRRS TKGGWTEEED 60 KILEFAVEKF GARNWKNIAE CVPDRTSVQC LHRWQKVLDP SLVKGPWTKE EDDLIIELVG 120 KQGNKKWSEI AKHLPGRIGK QCRERWHNHL NPDIKKTAWT KEEELTLIKA HEIYGNKWAE 180 IAKLLPGRYC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 1e-60 | 52 | 188 | 6 | 142 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-60 | 52 | 188 | 6 | 142 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Transcription activator involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:26069325}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constant levels during cell cycle. Activated by CYCB1. {ECO:0000269|PubMed:17287251}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021817082.1 | 6e-95 | uncharacterized protein LOC110759336 | ||||
Swissprot | Q9S7G7 | 8e-76 | MB3R1_ARATH; Transcription factor MYB3R-1 | ||||
TrEMBL | A0A2C9VV92 | 5e-93 | A0A2C9VV92_MANES; Uncharacterized protein | ||||
TrEMBL | M5XNR5 | 2e-92 | M5XNR5_PRUPE; Uncharacterized protein | ||||
STRING | XP_008232807.1 | 1e-93 | (Prunus mume) | ||||
STRING | cassava4.1_033700m | 8e-94 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1667 | 28 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G32730.1 | 3e-78 | Homeodomain-like protein |
Publications ? help Back to Top | |||
---|---|---|---|
|