PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_25391_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 70aa MW: 8152.16 Da PI: 5.6782 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 87.6 | 1.6e-27 | 10 | 68 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d++++++isw+e+g++fvv+++ +fak++Lp+yFkh+nf+SFvRQLn+Y Neem_25391_f_1 10 FLMKTYQLVDDPNTDDVISWNESGTTFVVWKTADFAKDLLPNYFKHNNFSSFVRQLNTY 68 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.2E-28 | 3 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.4E-20 | 6 | 70 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 2.84E-24 | 7 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.4E-17 | 10 | 33 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.3E-22 | 10 | 68 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.4E-17 | 48 | 60 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.4E-17 | 61 | 70 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
MTQRTVPAPF LMKTYQLVDD PNTDDVISWN ESGTTFVVWK TADFAKDLLP NYFKHNNFSS 60 FVRQLNTYVS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 2e-19 | 6 | 68 | 26 | 87 | Heat shock factor protein 1 |
5d5v_B | 2e-19 | 6 | 68 | 26 | 87 | Heat shock factor protein 1 |
5d5v_D | 2e-19 | 6 | 68 | 26 | 87 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021656118.1 | 5e-42 | heat shock factor protein HSF24 | ||||
Swissprot | P22335 | 8e-39 | HSF24_SOLPE; Heat shock factor protein HSF24 | ||||
TrEMBL | A0A2H5PJX4 | 4e-40 | A0A2H5PJX4_CITUN; Uncharacterized protein | ||||
STRING | XP_006466606.1 | 7e-41 | (Citrus sinensis) | ||||
STRING | XP_006425895.1 | 1e-40 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM965 | 28 | 111 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36990.1 | 6e-39 | heat shock factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|