PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_25355_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 201aa MW: 22869.2 Da PI: 6.5099 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 67.4 | 2.4e-21 | 128 | 177 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 k+r++W+ +LH++Fv+av+q+ G +k Pk+il+lm+v+ Lt+e+v+SHLQ Neem_25355_f_1 128 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQ 177 68*******************.9**************************** PP | |||||||
2 | Response_reg | 34.1 | 1.4e-12 | 1 | 56 | 53 | 109 |
CTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 53 mpgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109 mp+mdG++ll++ e +lp+i+++ ge + + + ++ Ga d+l Kp+ ++el++ Neem_25355_f_1 1 MPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKELRN 56 9************6644.8***********************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF52172 | 6.26E-16 | 1 | 71 | IPR011006 | CheY-like superfamily |
CDD | cd00156 | 2.68E-12 | 1 | 62 | No hit | No description |
PROSITE profile | PS50110 | 23.653 | 1 | 62 | IPR001789 | Signal transduction response regulator, receiver domain |
Pfam | PF00072 | 1.6E-9 | 1 | 57 | IPR001789 | Signal transduction response regulator, receiver domain |
Gene3D | G3DSA:3.40.50.2300 | 2.1E-21 | 1 | 69 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.7E-23 | 126 | 177 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.94E-14 | 126 | 179 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.1E-19 | 128 | 178 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.1E-6 | 130 | 177 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MPDMDGFKLL EHVGLEMDLP VIMMSVDGET SRVMKGVQHG ACDYLLKPIR MKELRNIWQH 60 VFRKRIHEVR DIENIEGFES IQMTRSGSDQ SDDGHFLPGE DLTFARKRKD AESKHDDKDS 120 GDASSTKKAR VVWSVDLHQK FVKAVNQIGF DKVGPKKILD LMNVPWLTRE NVASHLQIIT 180 FHLLLDSCAI HGDMSCENNV G |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 2e-15 | 124 | 177 | 1 | 54 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006438147.1 | 1e-114 | two-component response regulator ARR11 isoform X1 | ||||
Refseq | XP_006484016.1 | 1e-114 | two-component response regulator ARR11 isoform X1 | ||||
Refseq | XP_006484017.1 | 1e-114 | two-component response regulator ARR11 isoform X2 | ||||
Refseq | XP_024041181.1 | 1e-115 | two-component response regulator ARR11 isoform X2 | ||||
Refseq | XP_024041182.1 | 1e-115 | two-component response regulator ARR11 isoform X3 | ||||
Swissprot | Q5N6V8 | 9e-87 | ORR26_ORYSJ; Two-component response regulator ORR26 | ||||
TrEMBL | A0A2H5NV41 | 1e-113 | A0A2H5NV41_CITUN; Uncharacterized protein | ||||
TrEMBL | V4TDL1 | 1e-113 | V4TDL1_9ROSI; Uncharacterized protein | ||||
STRING | XP_006484017.1 | 1e-114 | (Citrus sinensis) | ||||
STRING | XP_006438147.1 | 1e-114 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8066 | 27 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G67710.1 | 2e-77 | response regulator 11 |
Publications ? help Back to Top | |||
---|---|---|---|
|