PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_24496_a_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 102aa MW: 11179.5 Da PI: 5.6796 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 69.4 | 1.2e-21 | 10 | 63 | 101 | 154 |
DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 ++slP +v+++a frc+rv+++ d+e+e++Y ++v+i+GhvfkG+Lyd+G +e Neem_24496_a_1 10 FKKSLPGQVQAAANFRCIRVTAITDDEAEVGYVATVNISGHVFKGYLYDHGYDE 63 4567***********************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 3.9E-19 | 8 | 62 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 2.8E-23 | 14 | 60 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MIDFRMKESF KKSLPGQVQA AANFRCIRVT AITDDEAEVG YVATVNISGH VFKGYLYDHG 60 YDEKKLFPCI SGMQMENDVS TARTRDSSSP VGDQSGYAAS GN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM) (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011020409.1 | 4e-34 | PREDICTED: protein LATERAL ROOT PRIMORDIUM 1 | ||||
Swissprot | Q9M2U4 | 3e-19 | SRS6_ARATH; Protein SHI RELATED SEQUENCE 6 | ||||
TrEMBL | B9GWY7 | 3e-32 | B9GWY7_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0003s19550.1 | 5e-33 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM11959 | 23 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54430.1 | 1e-21 | SHI-related sequence 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|