PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_24000_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

CAMTA

Protein Properties

Length: 132aa MW: 15745.4 Da PI: 10.3528

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_24000_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	113.9	9.1e-36	20	96	2	78
CG-1 2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggv 78 ++ ++rwl++ ei++iL n++k+ ++ e+++ p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LKv + Neem_24000_f_1 20 IEAQHRWLRPAEICEILRNYQKFCIAPEPPNMPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKVSTK 96 4569**********************************************************************984 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	49.568	15	132	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	1.3E-33	18	115	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	1.0E-31	21	100	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 132 aa Download sequence Send to blast
MADTRRFALG NQLDIEQLLI EAQHRWLRPA EICEILRNYQ KFCIAPEPPN MPPSGSLFLF 60 DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKVSTKFIIF SEQKSRSKLI ARDLSLFEIE 120 MLWDKIARCP EK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018847035.1	4e-56	PREDICTED: calmodulin-binding transcription activator 3
Swissprot	Q6NPP4	3e-48	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	A0A2I4GT10	9e-55	A0A2I4GT10_JUGRE; calmodulin-binding transcription activator 3
STRING	Pavir.J38535.1.p	6e-54	(Panicum virgatum)
STRING	Migut.L00133.1.p	2e-54	(Erythranthe guttata)
STRING	GSMUA_Achr3P21310_001	9e-54	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM25780	2	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	1e-50	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]