PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_2225_f_2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 166aa MW: 18868.1 Da PI: 8.5821 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 135.6 | 1.5e-42 | 65 | 142 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +C ve+C adl++a++yh+rhkvCe+hskapvv+v+gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a Neem_2225_f_2 65 CCVVEKCGADLTDARRYHKRHKVCEIHSKAPVVIVAGLRQRFCQQCSRFHELSEFDESKRSCRRRLAGHNERRRKSTA 142 6**************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.6E-34 | 60 | 127 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.505 | 63 | 140 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.18E-39 | 64 | 144 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.6E-32 | 66 | 139 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MDAASLEAKR LLKEKTIKEC FVEDDMDNEM EEEEEGGGDN YADDEKKKRV SGRRGPGAGG 60 VSTPCCVVEK CGADLTDARR YHKRHKVCEI HSKAPVVIVA GLRQRFCQQC SRFHELSEFD 120 ESKRSCRRRL AGHNERRRKS TAETTGESRQ QLSLQGNSSY RRSQTK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 7e-35 | 58 | 139 | 3 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006451806.1 | 5e-67 | squamosa promoter-binding-like protein 13 | ||||
Refseq | XP_006464784.1 | 5e-67 | squamosa promoter-binding-like protein 13 | ||||
Swissprot | Q38740 | 2e-44 | SBP2_ANTMA; Squamosa promoter-binding protein 2 | ||||
Swissprot | Q38741 | 2e-44 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A067FH62 | 1e-65 | A0A067FH62_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A2H5QHN5 | 1e-65 | A0A2H5QHN5_CITUN; Uncharacterized protein | ||||
TrEMBL | V4URD2 | 1e-65 | V4URD2_9ROSI; Squamosa promoter-binding protein 1 | ||||
STRING | XP_006464784.1 | 2e-66 | (Citrus sinensis) | ||||
STRING | XP_006451806.1 | 2e-66 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 9e-42 | squamosa promoter binding protein-like 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|