PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_18603_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CO-like
Protein Properties Length: 377aa    MW: 41948.4 Da    PI: 5.826
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_18603_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.41.9e-052061439
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    r+C+++     + +C+ +  +lC +C    H        H++
  Neem_18603_f_1 20 RVCDTCRAAACTVYCKADMAYLCSSCDARVHAAnrvasrHER 61
                    79******99******************99955567777766 PP

2zf-B_box29.51.5e-0963107442
        zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      +C+ +e+ ++ + C+ +   lC  C   +H+       H++vp+
  Neem_18603_f_1  63 FVCEACEQAPAAFLCKADAASLCTACDADIHSAnplarrHQRVPI 107
                     68*****************************66899999**9997 PP

3CCT70.44.7e-24308351144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Neem_18603_f_1 308 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 351
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.4E-81764IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4091764IPR000315B-box-type zinc finger
CDDcd000218.00E-82064No hitNo description
PROSITE profilePS5011911.39160107IPR000315B-box-type zinc finger
PfamPF006431.9E-763107IPR000315B-box-type zinc finger
CDDcd000216.26E-963107No hitNo description
SMARTSM003363.2E-1065107IPR000315B-box-type zinc finger
PfamPF062037.3E-18308350IPR010402CCT domain
PROSITE profilePS5101716.648308350IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MMKEESTDGS GGGGGNNWAR VCDTCRAAAC TVYCKADMAY LCSSCDARVH AANRVASRHE  60
RVFVCEACEQ APAAFLCKAD AASLCTACDA DIHSANPLAR RHQRVPILPI SGSLYGNRSG  120
RTPDRDWFLA PEGEEDEDEE EAASWLLLNP GKNSTNNNNN STNFFSGEVD EYLDLVDYNG  180
ENQCVDQYNN QQQRNEQYGF PQKGYLGDSV VPIQCEAMDK DNHRQHQQQH NQQIFHLGLE  240
YDSSKAGYSY NGSISHSVSV SSTDIGVVPE STTSDISISH SRPPKGTIDL FSGPPIQMPP  300
PQLTPLDREA RVLRYREKKK TRKFEKTIRY ASRKAYAETR PRIKGRFAKR TDVEVELDQM  360
FSTTLTAETG YGIVPSF
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430882.10.0zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-144COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A067EUU90.0A0A067EUU9_CITSI; Uncharacterized protein
STRINGXP_006430882.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-107CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]