PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_17575_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 133aa MW: 14216.6 Da PI: 6.2422 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 106.4 | 1.7e-33 | 63 | 119 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAas+Gg+avDGC+Efm+s geegt+aal+CaACgCHR+FHRrev++e Neem_17575_f_1 63 NVRYAECQKNHAASVGGYAVDGCREFMAS-GEEGTPAALTCAACGCHRSFHRREVQTE 119 79**************************9.999*********************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 3.0E-29 | 38 | 128 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 4.4E-31 | 63 | 116 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 4.7E-28 | 65 | 116 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.012 | 66 | 115 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MPVSDCGSGS GFQNSRTISR GFGGEEEEGG DNFVNSEMRK RQVVLRREEP SRTSSTSSVT 60 VRNVRYAECQ KNHAASVGGY AVDGCREFMA SGEEGTPAAL TCAACGCHRS FHRREVQTEV 120 VCECSSPPPS TGS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021297644.1 | 2e-57 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 2e-43 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A061EGD2 | 7e-54 | A0A061EGD2_THECC; Mini zinc finger 2 isoform 2 (Fragment) | ||||
STRING | EOY03457 | 1e-54 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM944 | 28 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 3e-40 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|