PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_15977_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

CAMTA

Protein Properties

Length: 112aa MW: 12931.1 Da PI: 10.7492

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_15977_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	84.9	8.7e-27	21	94	3	77
CG-1 3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvgg 77 + k+rwl + e+++iL n++k+++ +++++ p+sg++ + ++vr+fr+DG++w+kk+dgktv+E+h+kLKv + Neem_15977_f_1 21 QAKHRWLSAAEVCEILRNYQKFSVDSKPANMPPSGKMPIC-LEVVRFFRNDGHNWRKKRDGKTVKEAHKKLKVST 94 569*******************************9865.68****************************87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	31.307	15	112	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	4.8E-14	18	110	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	1.8E-22	22	98	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
MAETGRFADG NQLDMEKLRV QAKHRWLSAA EVCEILRNYQ KFSVDSKPAN MPPSGKMPIC 60 LEVVRFFRND GHNWRKKRDG KTVKEAHKKL KVSTKFIIFQ KIGPTLSSLK EI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018847035.1	4e-34	PREDICTED: calmodulin-binding transcription activator 3
Swissprot	Q6NPP4	2e-31	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	A0A1J3HQ35	4e-33	A0A1J3HQ35_NOCCA; Calmodulin-binding transcription activator 2 (Fragment)
TrEMBL	A0A2I4GT10	9e-33	A0A2I4GT10_JUGRE; calmodulin-binding transcription activator 3
STRING	XP_008369913.1	9e-37	(Malus domestica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	8e-34	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]