PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ahy022444

Organism

Arachis hypogaea

Taxonomic ID

3818

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

GRF

Protein Properties

Length: 191aa MW: 20055.4 Da PI: 10.2626

Description

GRF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Ahy#S58458179	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	70.3	2.4e-22	83	127	1	45
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 d+epgrCrRtDGKkWRCsr++ +++k+C+rH+ r r rsrk++e+ Ahy022444 83 DPEPGRCRRTDGKKWRCSREAHPDSKYCDRHMIRRRYRSRKPVES 127 79****************************************997 PP
2	QLQ	37.2	9.3e-14	31	59	9	37
QLQ 9 qlLksQilAyKyLaanqPvPpeLlqaiqk 37 q+L++Q+l++KyL a++ vPp+Ll++i++ Ahy022444 31 QELEHQALIFKYLKAGLTVPPDLLVPIRR 59 9**************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51666	14.177	24	59	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	1.1E-9	31	58	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	23.698	83	127	IPR014977	WRC domain
Pfam	PF08879	2.9E-19	84	126	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 191 aa Download sequence Send to blast
XDERSSTSPS SSDSSVDDVA GGAVHGGAVX QELEHQALIF KYLKAGLTVP PDLLVPIRRS 60 LQLMSQKLSH HYPSLGFYGK KIDPEPGRCR RTDGKKWRCS REAHPDSKYC DRHMIRRRYR 120 SRKPVESSTS SQQQSHSSAA ASAATAASTT TTTTTTTAAS AASAAGGGGG GGGGGASWVP 180 GGRPSTPTFP X

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that plays a role in the regulation of meristematic function in leaves, stems and inflorescences (PubMed:24532604). Transcription activator that plays a regulatory role in grain development (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates grain size by promoting cell division and expansion, leading to increased grain length and width (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates the expression of genes promoting cell proliferation (PubMed:26187814, PubMed:26936408). Activates the expression of expansin genes to promote cell expansion and grain size (PubMed:27250747). May promote grain size by activating brassinosteroid responses (PubMed:27250747). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (Probable). Component of the miRNA396c-GRF4-GIF1 regulatory module that plays an important role in grain size determination (Probable) (PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269\|PubMed:24532604, ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747, ECO:0000269\|PubMed:27250749, ECO:0000305\|PubMed:26187814, ECO:0000305\|PubMed:27107174, ECO:0000305\|PubMed:27250747, ECO:0000305\|PubMed:27250749}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: The microRNA396c negatively regulates GRF4 at the transcriptional level. {ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015963202.1	6e-67	growth-regulating factor 3
Refseq	XP_016201216.1	6e-67	growth-regulating factor 3
Refseq	XP_025651317.1	6e-67	growth-regulating factor 3-like
Refseq	XP_025697970.1	6e-67	growth-regulating factor 3-like
Swissprot	Q6ZIK5	1e-44	GRF4_ORYSJ; Growth-regulating factor 4
TrEMBL	A0A444WVK8	1e-65	A0A444WVK8_ARAHY; Uncharacterized protein
STRING	GLYMA01G35145.1	2e-56	(Glycine max)

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Hu J, et al. A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice. Mol Plant, 2015. 8(10): p. 1455-65 [PMID:26187814] Sun P, et al. OsGRF4 controls grain shape, panicle length and seed shattering in rice. J Integr Plant Biol, 2016. 58(10): p. 836-847 [PMID:26936408] Li S, et al. The OsmiR396c-OsGRF4-OsGIF1 regulatory module determines grain size and yield in rice. Plant Biotechnol. J., 2016. 14(11): p. 2134-2146 [PMID:27107174] Che R, et al. Control of grain size and rice yield by GL2-mediated brassinosteroid responses. Nat Plants, 2015. 2: p. 15195 [PMID:27250747] Duan P, et al. Regulation of OsGRF4 by OsmiR396 controls grain size and yield in rice. Nat Plants, 2015. 2: p. 15203 [PMID:27250749]