PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ahy017833 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 139aa MW: 15695.3 Da PI: 9.5974 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.5 | 1.7e-14 | 24 | 66 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g++T +Ed+l+ + + G++ W++Ia+ ++ gRt++++k++w++ Ahy017833 24 GAFTDDEDKLISTLYATIGSR-WSLIAAQLP-GRTDNDVKNHWNT 66 89*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.344 | 1 | 17 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-11 | 3 | 29 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.29E-23 | 4 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.176 | 18 | 72 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-12 | 22 | 70 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-13 | 24 | 66 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.25E-10 | 25 | 68 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-18 | 30 | 69 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
XLKRCGKSCR LRWLNYLRPH IKHGAFTDDE DKLISTLYAT IGSRWSLIAA QLPGRTDNDV 60 KNHWNTKLRK KFFAGGINTA NATTVLNTAS SKFPTFTPQI EAFDHNNNTP TTCFESAVLD 120 LYQTPFPVPS KMLPLESDX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-21 | 4 | 72 | 60 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025671013.1 | 8e-98 | transcription factor MYB87-like | ||||
Swissprot | Q9FKL2 | 1e-37 | MYB36_ARATH; Transcription factor MYB36 | ||||
TrEMBL | A0A445DUV8 | 2e-96 | A0A445DUV8_ARAHY; Uncharacterized protein | ||||
STRING | XP_007160258.1 | 2e-49 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G57620.1 | 1e-39 | myb domain protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|