PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ahy017824

Organism

Arachis hypogaea

Taxonomic ID

3818

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

CAMTA

Protein Properties

Length: 194aa MW: 22218.5 Da PI: 6.281

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Ahy#S59525229	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	111.2	6.1e-35	1	66	53	118
CG-1 53 DGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118 DG++w+kkkdgktvrE+he+LK g+v+vl+cyYah+een++fqrr+yw+L+eel++ivlvhy+evk Ahy017824 1 DGHNWRKKKDGKTVREAHERLKAGSVDVLHCYYAHGEENENFQRRTYWMLDEELSHIVLVHYREVK 66 9**************************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	51.289	1	71	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	1.1E-20	1	66	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	4.7E-29	1	64	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 194 aa Download sequence Send to blast
DGHNWRKKKD GKTVREAHER LKAGSVDVLH CYYAHGEENE NFQRRTYWML DEELSHIVLV 60 HYREVKATKA NFRGAAKENQ ESLPYAQIDK LPGSTEKEIS LSCSLHPHNY QVPSHTIDTT 120 SMKSTQATEY EEAESALNSY ASSEDYSFLE TQHPVVEKIP DPYCLLQFIN EQEKLCGTPG 180 MNHIMLSQAG KIKX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'. Binds calmodulin in a calcium-dependent manner in vitro (PubMed:12218065). Regulates transcriptional activity in response to calcium signals (Probable). Involved in freezing tolerance in association with CAMTA1 and CAMTA2 (PubMed:23581962). Required for the cold-induced expression of DREB1B/CBF1, DREB1C/CBF2, ZAT12 and GOLS3 (PubMed:19270186). Involved in response to cold. Contributes together with CAMTA5 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). Involved together with CAMTA2 and CAMTA4 in the positive regulation of a general stress response (GSR) (PubMed:25039701). Involved in the regulation of GSR amplitude downstream of MEKK1 (PubMed:25157030). Involved in the regulation of a set of genes involved in defense responses against pathogens (PubMed:18298954). Involved in the regulation of both basal resistance and systemic acquired resistance (SAR) (PubMed:21900483). Acts as negative regulator of plant immunity (PubMed:19122675, PubMed:21900483, PubMed:22345509, PubMed:28407487). Binds to the promoter of the defense-related gene EDS1 and represses its expression (PubMed:19122675). Binds to the promoter of the defense-related gene NDR1 and represses its expression (PubMed:22345509). Involved in defense against insects (PubMed:23072934, PubMed:22371088). Required for tolerance to the generalist herbivore Trichoplusia ni, and contributes to the positive regulation of genes associated with glucosinolate metabolism (PubMed:23072934). Required for tolerance to Bradysia impatiens larvae. Mediates herbivore-induced wound response (PubMed:22371088). Required for wound-induced jasmonate accumulation (PubMed:23072934, PubMed:22371088). Involved in the regulation of ethylene-induced senescence by binding to the promoter of the senescence-inducer gene EIN3 and repressing its expression (PubMed:22345509). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:18298954, ECO:0000269\|PubMed:19122675, ECO:0000269\|PubMed:19270186, ECO:0000269\|PubMed:21900483, ECO:0000269\|PubMed:22345509, ECO:0000269\|PubMed:22371088, ECO:0000269\|PubMed:23072934, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25157030, ECO:0000269\|PubMed:28351986, ECO:0000269\|PubMed:28407487, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat shock, UVB, salt, wounding, ethylene and methyl jasmonate (PubMed:11162426, PubMed:12218065). Induced by infection with the fungal pathogen Golovinomyces cichoracearum (powdery mildew) and the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000 (PubMed:22345509). {ECO:0000269\|PubMed:11162426, ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:22345509}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025691142.1	1e-135	calmodulin-binding transcription activator 3 isoform X2
Swissprot	Q8GSA7	2e-45	CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBL	A0A444ZU13	1e-134	A0A444ZU13_ARAHY; Uncharacterized protein
STRING	GLYMA08G14370.1	1e-81	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22300.2	8e-48	signal responsive 1

Publications ? help Back to Top
Zhang L,Du L,Shen C,Yang Y,Poovaiah BW Regulation of plant immunity through ubiquitin-mediated modulation of Ca(2+) -calmodulin-AtSR1/CAMTA3 signaling. Plant J., 2014. 78(2): p. 269-81 [PMID:24528504] Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Rahman H,Yang J,Xu YP,Munyampundu JP,Cai XZ Phylogeny of Plant CAMTAs and Role of AtCAMTAs in Nonhost Resistance to Xanthomonas oryzae pv. oryzae. Front Plant Sci, 2016. 7: p. 177 [PMID:26973658] Benn G, et al. Plastidial metabolite MEcPP induces a transcriptionally centered stress-response hub via the transcription factor CAMTA3. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(31): p. 8855-60 [PMID:27432993] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986] Lolle S, et al. Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles. Cell Host Microbe, 2017. 21(4): p. 518-529.e4 [PMID:28407487] Kim YS, et al. CAMTA-Mediated Regulation of Salicylic Acid Immunity Pathway Genes in Arabidopsis Exposed to Low Temperature and Pathogen Infection. Plant Cell, 2017. 29(10): p. 2465-2477 [PMID:28982964] Jacob F, et al. A dominant-interfering camta3 mutation compromises primary transcriptional outputs mediated by both cell surface and intracellular immune receptors in Arabidopsis thaliana. New Phytol., 2018. 217(4): p. 1667-1680 [PMID:29226970]