PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ahy011706 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 127aa MW: 14192.2 Da PI: 9.6982 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57.8 | 1.5e-18 | 12 | 45 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 Cs C+ttkTplWR gp g+k+ CnaCG++yrk++ Ahy011706 12 CSDCKTTKTPLWRGGPAGPKSFCNACGIRYRKRR 45 ********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 3.3E-14 | 6 | 56 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.71E-12 | 8 | 45 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 5.6E-15 | 10 | 45 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE profile | PS50114 | 12.044 | 12 | 42 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 1.6E-16 | 12 | 45 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 12 | 37 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 1.78E-11 | 12 | 63 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
XKEWVCESKK CCSDCKTTKT PLWRGGPAGP KSFCNACGIR YRKRRASAVG MRKGQERKRE 60 RSQNGGGSSS STSSFDNELK ESLKVNLMAL GEEFWLLKKK QRSMCLLGEE EQAAVCLMAL 120 FCGYVFA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016207532.1 | 2e-76 | GATA transcription factor 16 | ||||
Refseq | XP_025663075.1 | 2e-76 | GATA transcription factor 16 | ||||
Swissprot | Q9FJ10 | 1e-28 | GAT16_ARATH; GATA transcription factor 16 | ||||
TrEMBL | A0A444YJP2 | 5e-75 | A0A444YJP2_ARAHY; Uncharacterized protein | ||||
STRING | AES82392 | 1e-41 | (Medicago truncatula) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 1e-22 | GATA transcription factor 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|