PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ahy010678 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 141aa MW: 15889.2 Da PI: 8.2579 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 66.6 | 3.4e-21 | 39 | 94 | 1 | 56 |
TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+ qVk+WFqN+R++ k Ahy010678 39 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQVK 94 678899**********************************************9877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.4E-24 | 23 | 94 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.09E-20 | 24 | 96 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.811 | 36 | 96 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.2E-18 | 37 | 100 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 8.7E-19 | 39 | 94 | IPR001356 | Homeobox domain |
CDD | cd00086 | 4.94E-15 | 39 | 96 | No hit | No description |
PRINTS | PR00031 | 2.3E-5 | 67 | 76 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 71 | 94 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 2.3E-5 | 76 | 92 | IPR000047 | Helix-turn-helix motif |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
XSATKSGSEN LEVEGGGGSG GGGEGGSAGE DQNPRPNKKK RYHRHTQHQI QEMEAFFKEC 60 PHPDDKQRKE LSRELGLEPL QVKFWFQNKR TQVKTQTERS ENSQLRAENE KLRADNMRLD 120 PHSSNSTLLL DRGCNLNMPS P |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis. {ECO:0000269|PubMed:11846882}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015953298.2 | 2e-61 | LOW QUALITY PROTEIN: homeobox-leucine zipper protein HDG2 | ||||
Refseq | XP_016188415.1 | 2e-61 | homeobox-leucine zipper protein HDG2 | ||||
Refseq | XP_025643275.1 | 2e-61 | homeobox-leucine zipper protein HDG2 | ||||
Refseq | XP_025687365.1 | 2e-61 | homeobox-leucine zipper protein HDG2 | ||||
Swissprot | Q6ZAR0 | 1e-49 | ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1 | ||||
TrEMBL | A0A445A608 | 5e-60 | A0A445A608_ARAHY; Uncharacterized protein | ||||
TrEMBL | A0A445E0W4 | 6e-60 | A0A445E0W4_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA12G32050.3 | 3e-57 | (Glycine max) | ||||
STRING | GLYMA13G38430.1 | 3e-57 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G05230.4 | 8e-46 | homeodomain GLABROUS 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|