PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ahy008129

Organism

Arachis hypogaea

Taxonomic ID

3818

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

bHLH

Protein Properties

Length: 92aa MW: 10867.3 Da PI: 6.6841

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Ahy#S59554036	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	42.2	1.5e-13	37	86	4	55
HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 +hn+ Er RR++iN ++ Lr++lP a + kK+s ++ ++ +YI +Lq Ahy008129 37 NHNASERHRRKKINALYSSLRSILPVA--DQTKKMSIPATISRVLKYIPELQ 86 8***********************6..48888**************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47459	2.75E-15	33	92	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profile	PS50888	13.624	33	85	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	4.6E-13	34	90	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
CDD	cd00083	4.57E-10	34	90	No hit	No description
Pfam	PF00010	6.3E-11	37	86	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SMART	SM00353	1.5E-10	39	91	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MEWPLELEEE ELSHSHHEYF NSEEYPLLSS SMAKKFNHNA SERHRRKKIN ALYSSLRSIL 60 PVADQTKKMS IPATISRVLK YIPELQQQVE EL

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by OBP3, auxin and salicylic acid (SA). Repressed by jasmonic acid (JA), UV LIGHT, and heat treatments. Up regulated by iron deficiency in roots and leaves, as well as by nickel, high zinc or high copper treatments. Repressed by high iron, low copper and low zinc treatments. {ECO:0000269\|PubMed:12679534, ECO:0000269\|PubMed:12887587, ECO:0000269\|PubMed:17516080}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025604301.1	3e-60	transcription factor bHLH100
Swissprot	Q9M1K1	1e-24	ORG2_ARATH; Transcription factor ORG2
TrEMBL	A0A445CLU9	8e-59	A0A445CLU9_ARAHY; Uncharacterized protein
STRING	VIT_13s0047g00450.t01	1e-26	(Vitis vinifera)
STRING	GLYMA19G31351.1	2e-27	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G56970.1	7e-27	bHLH family protein

Publications ? help Back to Top
Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature. Differentiation, 2010. 80(1): p. 1-8 [PMID:20219281] Matsuoka K, et al. Gibberellin-induced expression of Fe uptake-related genes in Arabidopsis. Plant Cell Physiol., 2014. 55(1): p. 87-98 [PMID:24192296] Li X,Zhang H,Ai Q,Liang G,Yu D Two bHLH Transcription Factors, bHLH34 and bHLH104, Regulate Iron Homeostasis in Arabidopsis thaliana. Plant Physiol., 2016. 170(4): p. 2478-93 [PMID:26921305] Shen C, et al. Involvement of endogenous salicylic acid in iron-deficiency responses in Arabidopsis. J. Exp. Bot., 2016. 67(14): p. 4179-93 [PMID:27208542] Liang G,Zhang H,Li X,Ai Q,Yu D bHLH transcription factor bHLH115 regulates iron homeostasis in Arabidopsis thaliana. J. Exp. Bot., 2017. 68(7): p. 1743-1755 [PMID:28369511] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Kailasam S,Wang Y,Lo JC,Chang HF,Yeh KC S-Nitrosoglutathione works downstream of nitric oxide to mediate iron-deficiency signaling in Arabidopsis. Plant J., 2018. 94(1): p. 157-168 [PMID:29396986] Kurt F,Filiz E Genome-wide and comparative analysis of bHLH38, bHLH39, bHLH100 and bHLH101 genes in Arabidopsis, tomato, rice, soybean and maize: insights into iron (Fe) homeostasis. Biometals, 2018. 31(4): p. 489-504 [PMID:29546482]