PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ahy007414 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 152aa MW: 16909.7 Da PI: 6.7957 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.4 | 6.5e-56 | 14 | 109 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 ++qdrflPianvsrimkk+lP nakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk+yl++yre+eg+k Ahy007414 14 EQQDRFLPIANVSRIMKKALPPNAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKLYLNNYRETEGDK 109 579*******************************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-53 | 9 | 117 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.95E-41 | 16 | 126 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.5E-28 | 19 | 83 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.6E-19 | 47 | 65 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 50 | 66 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.6E-19 | 66 | 84 | No hit | No description |
PRINTS | PR00615 | 8.6E-19 | 85 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
PTSGNISDSS SSKEQQDRFL PIANVSRIMK KALPPNAKIS KEAKETVQEC VSEFISFITG 60 EASDKCQREK RKTINGDDLL WAMTTLGFEN YVGPLKLYLN NYRETEGDKT SMPVNHHHHH 120 HSPEPNNHHH GVADFAGFNG NNNDGGFYSV GP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 6e-48 | 15 | 104 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 6e-48 | 15 | 104 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015956005.1 | 1e-112 | nuclear transcription factor Y subunit B-like | ||||
Refseq | XP_025689760.1 | 1e-112 | nuclear transcription factor Y subunit B-like | ||||
Swissprot | O23310 | 8e-61 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A445DSA6 | 1e-110 | A0A445DSA6_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA08G14931.1 | 1e-74 | (Glycine max) |
Publications ? help Back to Top | |||
---|---|---|---|
|