PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_016624-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9469.21 Da PI: 10.6689

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_016624-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	84.3	7.4e-27	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELS+LCdae+ +i+fsst+kl+eys+ AHYPO_016624-RA 9 KKIDNITTRQVTFSKRRRGLIKKAQELSTLCDAEIGLIVFSSTNKLFEYSN 59 68***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	9.5E-37	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.89E-27	1	62	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	28.315	1	61	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.6E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.7E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.6E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.6E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MVRQRIQIKK IDNITTRQVT FSKRRRGLIK KAQELSTLCD AEIGLIVFSS TNKLFEYSNS 60 RFYLYLYALS IVIFLYINKV *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-18	1	60	1	60	MEF2C
5f28_B	2e-18	1	60	1	60	MEF2C
5f28_C	2e-18	1	60	1	60	MEF2C
5f28_D	2e-18	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
UniProt	Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269\|PubMed:12451184, ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:12881501, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18466303, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18694458}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021775635.1	5e-34	MADS-box protein AGL24-like
Refseq	XP_021775643.1	5e-34	MADS-box protein AGL24-like
Refseq	XP_021775649.1	5e-34	MADS-box protein AGL24-like
Refseq	XP_021775653.1	5e-34	MADS-box protein AGL24-like
Refseq	XP_021775660.1	5e-34	MADS-box protein AGL24-like
Swissprot	O82794	6e-26	AGL24_ARATH; MADS-box protein AGL24
Swissprot	Q9FUY6	1e-25	JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBL	A0A0K9QJB0	7e-35	A0A0K9QJB0_SPIOL; Uncharacterized protein
STRING	XP_010690400.1	1e-31	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G24540.1	2e-28	AGAMOUS-like 24

Link Out ? help Back to Top
Phytozome	AHYPO_016624-RA

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Lei HJ, et al. Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry. Gene, 2013. 531(2): p. 158-67 [PMID:24055423] Nakano T,Kato H,Shima Y,Ito Y Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities. Plant Cell Physiol., 2015. 56(6): p. 1097-106 [PMID:25746985] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148] Sun LM,Zhang JZ,Hu CG Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.). Front Plant Sci, 2016. 7: p. 823 [PMID:27375669]