PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AHYPO_010207-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 156aa MW: 17463 Da PI: 10.1817 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 134.3 | 5.9e-42 | 50 | 154 | 1 | 107 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkal 94 s+yk kaal+v+++ ++f l+sg++kl +G ++l++a+ +r+ydW++kq+fals+ e+++lv+l+skescef hdp +++ eGkvrk+l AHYPO_010207-RA 50 SIYKEKAALTVEPRPTEFAPLESGAFKLAWEGYIMLQFAPR--VRQYDWSRKQVFALSVSEIGTLVSLGSKESCEFIHDPNKGNRYEGKVRKVL 141 79************************************996..6************************************************** PP Whirly 95 kvePlpdGsGlfv 107 kvePl dG G+f+ AHYPO_010207-RA 142 KVEPLVDGNGYFF 154 ************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 1.0E-44 | 41 | 154 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 3.3E-37 | 44 | 154 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 9.7E-39 | 51 | 154 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
ATALLAAQHL DDEPGFSLSP KSSVNTKAGF SRGNNRKYQG LRRKVLVGHS IYKEKAALTV 60 EPRPTEFAPL ESGAFKLAWE GYIMLQFAPR VRQYDWSRKQ VFALSVSEIG TLVSLGSKES 120 CEFIHDPNKG NRYEGKVRKV LKVEPLVDGN GYFFKP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 4e-55 | 44 | 155 | 37 | 150 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 4e-55 | 44 | 155 | 37 | 150 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 4e-55 | 44 | 155 | 37 | 150 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 4e-55 | 44 | 155 | 37 | 150 | p24: plant transcriptional regulator PBF-2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021746193.1 | 6e-56 | single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
Swissprot | Q9LL85 | 6e-55 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | A0A2J6JVE6 | 2e-53 | A0A2J6JVE6_LACSA; Uncharacterized protein | ||||
STRING | XP_010683246.1 | 3e-55 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14410.1 | 1e-54 | ssDNA-binding transcriptional regulator |
Link Out ? help Back to Top | |
---|---|
Phytozome | AHYPO_010207-RA |