PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AHYPO_004345-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 94aa MW: 10891.5 Da PI: 10.0256 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 102.1 | 2.1e-32 | 27 | 77 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++ AHYPO_004345-RA 27 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 77 79***********************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.3E-41 | 19 | 78 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.431 | 19 | 79 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.35E-40 | 20 | 77 | No hit | No description |
SuperFamily | SSF55455 | 7.06E-31 | 20 | 88 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 21 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-34 | 21 | 41 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-27 | 28 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-34 | 41 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-34 | 56 | 77 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MEFNPQSMET GSPSSQRKLG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA YELSVLCDAE 60 VALIVFSSRG RLYEYANHRY IIYLINSYFP FYA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-21 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021764207.1 | 6e-46 | floral homeotic protein AGAMOUS-like isoform X2 | ||||
Refseq | XP_021764209.1 | 5e-46 | floral homeotic protein AGAMOUS-like isoform X4 | ||||
Swissprot | Q40885 | 2e-39 | AG_PETHY; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A221C744 | 5e-45 | A0A221C744_AMATR; AGAMOUS protein | ||||
STRING | XP_010687169.1 | 5e-44 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.2 | 6e-41 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | AHYPO_004345-RA |
Publications ? help Back to Top | |||
---|---|---|---|
|