PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_002682-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

M-type_MADS

Protein Properties

Length: 80aa MW: 9167.09 Da PI: 10.7872

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_002682-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	84.7	5.4e-27	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v ifs++gklye + AHYPO_002682-RA 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVFIFSPQGKLYELA 58 79*********************************************965 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.744	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.35E-26	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.1E-36	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.71E-34	2	61	No hit	No description
PRINTS	PR00404	8.3E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.4E-24	10	56	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0048364	Biological Process	root development
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
MARGKVQLKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVFIFSP QGKLYELATK 60 GYVCLKFYFF LKKFSLLRP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	8e-16	1	59	1	59	MEF2C
5f28_B	8e-16	1	59	1	59	MEF2C
5f28_C	8e-16	1	59	1	59	MEF2C
5f28_D	8e-16	1	59	1	59	MEF2C
6byy_A	8e-16	1	59	1	59	MEF2 CHIMERA
6byy_B	8e-16	1	59	1	59	MEF2 CHIMERA
6byy_C	8e-16	1	59	1	59	MEF2 CHIMERA
6byy_D	8e-16	1	59	1	59	MEF2 CHIMERA
6bz1_A	8e-16	1	59	1	59	MEF2 CHIMERA
6bz1_B	8e-16	1	59	1	59	MEF2 CHIMERA
6bz1_C	8e-16	1	59	1	59	MEF2 CHIMERA
6bz1_D	8e-16	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012854701.1	1e-35	PREDICTED: MADS-box transcription factor 26
Swissprot	Q38841	2e-35	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	A0A059BU68	7e-34	A0A059BU68_EUCGR; Uncharacterized protein
TrEMBL	M4DI01	3e-34	M4DI01_BRARP; Uncharacterized protein
STRING	XP_010534127.1	1e-34	(Tarenaya hassleriana)
STRING	Bra016128.1-P	5e-35	(Brassica rapa)
STRING	XP_010062376.1	1e-34	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	1e-37	AGAMOUS-like 12

Link Out ? help Back to Top
Phytozome	AHYPO_002682-RA

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]