PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.9281s0002.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 177aa MW: 19899.5 Da PI: 10.4443 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.4 | 3.8e-14 | 8 | 52 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++l++ + ++ G+g+Wk I+r + k Rt q+ s+ qky Araha.9281s0002.1.p 8 PWTEEEHKLFLLGLQRVGKGDWKGISRNFVKSRTSTQVASHAQKY 52 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.687 | 1 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.23E-17 | 3 | 58 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.4E-17 | 4 | 55 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 2.1E-9 | 5 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.1E-11 | 7 | 52 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.25E-9 | 8 | 53 | No hit | No description |
Pfam | PF00249 | 7.1E-11 | 8 | 52 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
RERKRGVPWT EEEHKLFLLG LQRVGKGDWK GISRNFVKSR TSTQVASHAQ KYFLRRSNLN 60 RRRRRSSLFD MTTDTVMPME EDQVLMQENA SQLSSPVPEI NNFSIHPVMQ VFPEFPVPTG 120 NQPYGQLTSS INLTNLVPLT FQSSPAPLSL NLSLASSYHN EPSPSMHSAF NTIGVA* |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00236 | DAP | Transfer from AT1G74840 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.9281s0002.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY070098 | 0.0 | AY070098.1 Arabidopsis thaliana putative myb-related transcription activator protein (At1g74840) mRNA, complete cds. | |||
GenBank | AY088974 | 0.0 | AY088974.1 Arabidopsis thaliana clone 117643 mRNA, complete sequence. | |||
GenBank | AY096393 | 0.0 | AY096393.1 Arabidopsis thaliana putative myb-related transcription activator (At1g74840) mRNA, complete cds. | |||
GenBank | AY519510 | 0.0 | AY519510.1 Arabidopsis thaliana MYB transcription factor (At1g74840) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020891423.1 | 2e-97 | transcription factor MYB1R1 | ||||
TrEMBL | Q9S7N6 | 4e-90 | Q9S7N6_ARATH; F25A4.19 protein | ||||
STRING | AT1G74840.1 | 6e-91 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2461 | 26 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74840.1 | 9e-89 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.9281s0002.1.p |