PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.8604s0004.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 165aa MW: 19096.2 Da PI: 4.9176 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.7 | 2.2e-09 | 107 | 141 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp++ ++ LA+++gL+++q+ +WF N+R ++ Araha.8604s0004.1.p 107 KWPYPTEGDKLALAEETGLDQKQINNWFINQRKRH 141 569*****************************985 PP | |||||||
2 | ELK | 34.9 | 3.4e-12 | 61 | 82 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK+qLlrK++++++sLk EFs Araha.8604s0004.1.p 61 DLKDQLLRKFGSHISSLKLEFS 82 6********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 4.2E-6 | 61 | 82 | IPR005539 | ELK domain |
Pfam | PF03789 | 3.1E-9 | 61 | 82 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.935 | 61 | 81 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.244 | 81 | 144 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.37E-19 | 82 | 154 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 2.8E-11 | 83 | 148 | IPR001356 | Homeobox domain |
CDD | cd00086 | 8.78E-12 | 84 | 145 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.1E-27 | 86 | 145 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 7.7E-18 | 101 | 140 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 119 | 142 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009736 | Biological Process | cytokinin-activated signaling pathway | ||||
GO:0010094 | Biological Process | specification of carpel identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
VVITCLENSN ANNLIINQVN QVKTPPNSGQ YDDGAVSSDE ELREDDDVAA QDIQQRSNDR 60 DLKDQLLRKF GSHISSLKLE FSKKKKNGKL PREARQALLD WWNVHYKWPY PTEGDKLALA 120 EETGLDQKQI NNWFINQRKR HWKPSENMPF AMMDDSNETF FTEE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.8604s0004.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | X81353 | 1e-173 | X81353.1 A.thaliana mRNA for ATK1 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018471943.1 | 3e-84 | PREDICTED: homeobox protein knotted-1-like 2 isoform X1 | ||||
Swissprot | P46640 | 7e-84 | KNAT2_ARATH; Homeobox protein knotted-1-like 2 | ||||
TrEMBL | A0A178WJ00 | 1e-82 | A0A178WJ00_ARATH; KNAT2 | ||||
STRING | Bostr.10273s0307.1.p | 2e-87 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G70510.1 | 6e-78 | KNOTTED-like from Arabidopsis thaliana 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.8604s0004.1.p |