PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.7612s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 497aa    MW: 55467.2 Da    PI: 9.1187
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.7612s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.2e-182176257
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         +kR   t+ q+ +Le+++++++yp++e++ +LA+++gLte+qV+ WF+ rR k+k+
  Araha.7612s0010.1.p 21 KKRKLKTPIQVMALENFYNEHKYPTEEMKGKLAEEIGLTEKQVSGWFCHRRLKDKR 76
                         8999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-20477IPR009057Homeodomain-like
SuperFamilySSF466895.56E-171679IPR009057Homeodomain-like
PROSITE profilePS5007116.5031777IPR001356Homeobox domain
SMARTSM003899.1E-191981IPR001356Homeobox domain
PfamPF000461.6E-152176IPR001356Homeobox domain
CDDcd000864.74E-172177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MHSDSGEAPA DGDKASTENS KKRKLKTPIQ VMALENFYNE HKYPTEEMKG KLAEEIGLTE  60
KQVSGWFCHR RLKDKRHVKE DGNAIGSQDR SSVVLQDRGS GLRQDSCGST KQTDYWNPKP  120
REVESQRLYG GSYMGNADGE DSTSSDRSSS LHKNLVSSKD GIRDVESSRY VAHKDVIQHP  180
QVMRSYGYNK PSGYLKVKGE SENFAITAVK RQLGRQYQED GPPLGVEFDP LPPGAFEPQT  240
NAIVQEPIYI GNQRRSHPPH LLGTRKSFNP GPSYELARKS KMHSPDPDSE DDDDDDDIMV  300
GMEPGLRDKK SLGEPRLKSP SPSFYNSVPH HKSFKETLKG SPREIPVTNS KNGRISSKSW  360
AEGSRNNMIA NFHNLSGSNI ETNQSHDYDK HILNGGRKTG YLTKSSKLLP PSRSRSPDSM  420
DRGPSSGMAG KYHGEWNQMK THREKLHSTD EPPVAKRVKH GYIQQVYAPK SSYRQINRSS  480
LSGDDETDET SSSSMD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.7612s0010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412960.0AJ441296.1 Arabidopsis thaliana mRNA for homeodomain protein 14 (hd-14 gene).
GenBankBT0263720.0BT026372.1 Arabidopsis thaliana At4g03250 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002874873.20.0uncharacterized protein LOC9310940
TrEMBLA0A178UX160.0A0A178UX16_ARATH; Uncharacterized protein
STRINGBostr.2983s0116.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122022531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.10.0HB-other family protein