PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.7206s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 597aa    MW: 67104 Da    PI: 5.983
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.7206s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3733.6e-23128228198
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv++++L +gD +vF 
  Araha.7206s0008.1.p 128 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFL 215
                          89****************************9543..445569************************************************ PP

                          E-SSSEE..EEEEE- CS
                   B3  84 ldgrsefelvvkvfr 98 
                            + +++ l+v+v+r
  Araha.7206s0008.1.p 216 --RGENGDLRVGVRR 228
                          ..3488889***998 PP

2Auxin_resp96.24.9e-32254333183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha++t+++F v+Y+Pr   s+F+v v+k+++a+k+ +s+G+Rf+m+fe+e+s+er ++Gt+vg+ dl++ +Wp SkWrsL+
  Araha.7206s0008.1.p 254 ASHAVRTTTIFVVFYKPRI--SQFIVGVNKYMEAIKHGFSLGTRFRMRFEGEESPERIFTGTIVGTGDLSS-QWPASKWRSLQ 333
                          689***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.05E-40113257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.1E-38122243IPR015300DNA-binding pseudobarrel domain
CDDcd100178.77E-20126228No hitNo description
PROSITE profilePS5086312.083128230IPR003340B3 DNA binding domain
PfamPF023623.1E-21128228IPR003340B3 DNA binding domain
SMARTSM010191.3E-20128230IPR003340B3 DNA binding domain
PfamPF065073.7E-29254333IPR010525Auxin response factor
PfamPF023095.6E-8482527IPR033389AUX/IAA domain
SuperFamilySSF542777.85E-13490567No hitNo description
PROSITE profilePS5174526.283491583IPR000270PB1 domain
PfamPF023092.5E-5537576IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MASVEGDDDF GSSSSRFYQD QLYTELWKVC AGPLVEVPRA DERVFYFPQG HMEQLVASTN  60
QGIKSEEIPV FDLPPKILCR VLGVTLKAEH ETDEVYAQIT LQPEEDQSEP TSLDPPLVEP  120
TKQMFHSFVK ILTASDTSTH GGFSVLRKHA TECLPALDMT QATPTQELVT RDLHGFEWRF  180
KHIFRGQPRR HLLTTGWSTF VSSKRLVAGD AFVFLRGENG DLRVGVRRLA RHQSTMPTSV  240
ISSQSMHLGV LATASHAVRT TTIFVVFYKP RISQFIVGVN KYMEAIKHGF SLGTRFRMRF  300
EGEESPERIF TGTIVGTGDL SSQWPASKWR SLQVQWDEPT TVQRPDKVSP WEIEPFLATS  360
PISTPAQQPQ SKCKRSRPIE PSVITPAPPS FLYSLPQSQD SINASLKLFQ DPSLERNSGG  420
YSSNNSFKPE TPPPPPPTNC SYRLFGFDLT SNPPAPIPQD KQPMDTCGAA KCQEPITPTS  480
MNEQKKQQTS RSRTKVQMQG IAVGRAVDLT LLKSYDELIE ELEEMFEIQG QLRPRDKWIV  540
VFTDDEGDMM LAGDDPWNEF CKMAKKIFIY SSDEVKKMTT KLKISSSLEN EEYGNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1632036017359Auxin response factor 1
4ldw_A1e-1632036017359Auxin response factor 1
4ldw_B1e-1632036017359Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.7206s0008.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3347170.0AF334717.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0597460.0AY059746.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0704630.0AY070463.1 Arabidopsis thaliana AT3g61830/F15G16_220 mRNA, complete cds.
GenBankAY0913920.0AY091392.1 Arabidopsis thaliana putative auxin response factor protein (At3g61830) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020880816.10.0auxin response factor 18
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A178V7A70.0A0A178V7A7_ARATH; Auxin response factor
STRINGAT3G61830.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]