PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.7037s0004.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 83aa MW: 9113.34 Da PI: 5.5811 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 71.5 | 1.8e-22 | 1 | 66 | 36 | 101 |
DUF260 36 lFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101 ++Ga nv+k+l++lp+++r +a++sl++eA++r++dPvyG+vg+i+ lq q++q++++la++++e+ Araha.7037s0004.1.p 1 IYGAGNVSKMLQQLPDQTRAEAVESLCFEAKCRVDDPVYGCVGIIHFLQTQIQQTQNQLAKTQAEI 66 79***********************************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 1.2E-20 | 1 | 63 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 13.036 | 1 | 66 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
IYGAGNVSKM LQQLPDQTRA EAVESLCFEA KCRVDDPVYG CVGIIHFLQT QIQQTQNQLA 60 KTQAEIALAQ TKLSQTHNSD FM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-17 | 1 | 66 | 46 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-17 | 1 | 66 | 46 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.7037s0004.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB473847 | 1e-113 | AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds. | |||
GenBank | DQ056609 | 1e-113 | DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_189300.1 | 1e-50 | LOB domain-containing protein 24 | ||||
Swissprot | P59468 | 1e-51 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | R0FT52 | 7e-46 | R0FT52_9BRAS; Uncharacterized protein | ||||
STRING | AT3G26660.1 | 5e-50 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 9e-43 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.7037s0004.1.p |