PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.6174s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 179aa    MW: 19853.9 Da    PI: 9.1693
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.6174s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.41.6e-1571116853
                          -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
             Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                          t+  +++L   F++nryp+++++e LAk+l++t +qV +WF+NrR 
  Araha.6174s0001.1.p  71 TDPKTQRLYISFQENRYPDKAAKESLAKELQMTVTQVNNWFKNRRS 116
                          5667899999***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-1550115IPR009057Homeodomain-like
SuperFamilySSF466897.52E-1562117IPR009057Homeodomain-like
SMARTSM003897.0E-1263125IPR001356Homeobox domain
CDDcd000861.56E-1271115No hitNo description
PfamPF000465.3E-1371116IPR001356Homeobox domain
PROSITE profilePS5007113.00571121IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGKEDSESED EGDIVPLKQS SNAEDDTSKK PRRKSKRTDK KDTLEVPQEC PGENGGSGKI  60
DKSSSSACKQ TDPKTQRLYI SFQENRYPDK AAKESLAKEL QMTVTQVNNW FKNRRSSINS  120
KPLVSEENVE KLKTGKEGEC ETSLAGSSIQ TMETESVAEN KSRASESTNT GSRKRRRK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12836KKPRRKSKR
2172176RKRRR
Functional Description ? help Back to Top
Source Description
UniProtBinds only to large DNA fragments. Recognizes a DNA fragment carrying 8 copies of box7 motif of the light-induced cab-E promoter of Nicotiana plumbaginifolia. Also recognizes the box7m1 motif.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.6174s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1171050.0AK117105.1 Arabidopsis thaliana At3g19510 mRNA for putative homeobox protein HAT3.1, complete cds, clone: RAFL16-64-G01.
GenBankBT0059650.0BT005965.1 Arabidopsis thaliana At3g19510 gene, complete cds.
GenBankX695120.0X69512.1 A.thaliana HAT3.1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020888181.11e-111homeobox protein HAT3.1
RefseqXP_020888182.11e-111homeobox protein HAT3.1
SwissprotQ049961e-95HAT31_ARATH; Homeobox protein HAT3.1
TrEMBLD7L9Z91e-110D7L9Z9_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.3__2167__AT3G19510.11e-111(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72702543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-72Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain
Publications ? help Back to Top
  1. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]