PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.6174s0001.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 179aa MW: 19853.9 Da PI: 9.1693 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 48.4 | 1.6e-15 | 71 | 116 | 8 | 53 |
-HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS Homeobox 8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 t+ +++L F++nryp+++++e LAk+l++t +qV +WF+NrR Araha.6174s0001.1.p 71 TDPKTQRLYISFQENRYPDKAAKESLAKELQMTVTQVNNWFKNRRS 116 5667899999***********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.7E-15 | 50 | 115 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 7.52E-15 | 62 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 7.0E-12 | 63 | 125 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.56E-12 | 71 | 115 | No hit | No description |
Pfam | PF00046 | 5.3E-13 | 71 | 116 | IPR001356 | Homeobox domain |
PROSITE profile | PS50071 | 13.005 | 71 | 121 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MGKEDSESED EGDIVPLKQS SNAEDDTSKK PRRKSKRTDK KDTLEVPQEC PGENGGSGKI 60 DKSSSSACKQ TDPKTQRLYI SFQENRYPDK AAKESLAKEL QMTVTQVNNW FKNRRSSINS 120 KPLVSEENVE KLKTGKEGEC ETSLAGSSIQ TMETESVAEN KSRASESTNT GSRKRRRK* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 28 | 36 | KKPRRKSKR |
2 | 172 | 176 | RKRRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds only to large DNA fragments. Recognizes a DNA fragment carrying 8 copies of box7 motif of the light-induced cab-E promoter of Nicotiana plumbaginifolia. Also recognizes the box7m1 motif. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.6174s0001.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117105 | 0.0 | AK117105.1 Arabidopsis thaliana At3g19510 mRNA for putative homeobox protein HAT3.1, complete cds, clone: RAFL16-64-G01. | |||
GenBank | BT005965 | 0.0 | BT005965.1 Arabidopsis thaliana At3g19510 gene, complete cds. | |||
GenBank | X69512 | 0.0 | X69512.1 A.thaliana HAT3.1 mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020888181.1 | 1e-111 | homeobox protein HAT3.1 | ||||
Refseq | XP_020888182.1 | 1e-111 | homeobox protein HAT3.1 | ||||
Swissprot | Q04996 | 1e-95 | HAT31_ARATH; Homeobox protein HAT3.1 | ||||
TrEMBL | D7L9Z9 | 1e-110 | D7L9Z9_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.3__2167__AT3G19510.1 | 1e-111 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7270 | 25 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G19510.1 | 4e-72 | Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.6174s0001.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|