PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.2482s0001.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 101aa MW: 10807.1 Da PI: 8.2928 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 107.9 | 5.7e-34 | 30 | 87 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt aal+CaACgCHR+FHRre e+e Araha.2482s0001.1.p 30 TVRYGECQKNHAAAVGGYAVDGCREFMASRGEEGTLAALTCAACGCHRSFHRREIETE 87 79****************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 2.0E-24 | 1 | 97 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.8E-29 | 31 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 8.6E-28 | 32 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 24.677 | 33 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MRKRQVVLRR ASPEEPSRSS STASSLTVRT VRYGECQKNH AAAVGGYAVD GCREFMASRG 60 EEGTLAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.2482s0001.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK221094 | 1e-131 | AK221094.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-84-D24. | |||
GenBank | AP000386 | 1e-131 | AP000386.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone:MLD15. | |||
GenBank | BT024663 | 1e-131 | BT024663.1 Arabidopsis thaliana unknown protein (At3g28917) mRNA, complete cds. | |||
GenBank | CP002686 | 1e-131 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002875479.1 | 8e-68 | mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 2e-68 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | D7LM58 | 2e-66 | D7LM58_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.5__653__AT3G28917.1 | 3e-67 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM944 | 28 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 2e-36 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.2482s0001.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|