PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.20256s0002.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 163aa MW: 18342.7 Da PI: 8.0721 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 108 | 5e-34 | 37 | 91 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWt+eLHerF++av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl Araha.20256s0002.1.p 37 KPRLRWTSELHERFIDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRL 91 79****************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.706 | 34 | 94 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-32 | 34 | 93 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.87E-17 | 36 | 93 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 8.7E-25 | 37 | 92 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 4.2E-8 | 39 | 89 | IPR001005 | SANT/Myb domain |
Pfam | PF14379 | 2.9E-10 | 135 | 163 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MYSAIRSSLP LDGSLGDYSD GTNLPIDACL VLTTDPKPRL RWTSELHERF IDAVTQLGGP 60 DKATPKTIMR TMGVKGLTLY HLKSHLQKFR LGRQSCKESI DNSKDVSCVA ESQDTSSSST 120 SSLRLVAQEQ NESYQVTEAL RAQMEVQRRL HEQLEYAQVQ RRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.20256s0002.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK226443 | 0.0 | AK226443.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL06-12-H15. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006284218.1 | 1e-116 | protein PHR1-LIKE 3 isoform X1 | ||||
Swissprot | Q8LAJ7 | 1e-113 | PHL3_ARATH; Protein PHR1-LIKE 3 | ||||
TrEMBL | R0F6H8 | 1e-115 | R0F6H8_9BRAS; Uncharacterized protein | ||||
STRING | XP_006284218.1 | 1e-116 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3515 | 25 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G13640.2 | 1e-114 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.20256s0002.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|