PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.19277s0005.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 171aa MW: 20164.5 Da PI: 10.0116 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.2 | 1.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRr g++KKA+ELSvLCda+va i+fs++g+l+eyss Araha.19277s0005.1.p 9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIVFSQSGRLHEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 66 | 1.3e-22 | 85 | 170 | 11 | 96 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 e+ ++l+ e++++ k+i+ L+ +R+llG++L+s+s+ eLq++ +q+eksl +Rs+K el+ +q+++l++ke+el +e k+Lr+ Araha.19277s0005.1.p 85 ERYLQELKMEMNRMVKKIDLLEVHHRKLLGKGLDSCSVAELQEIDTQIEKSLLIVRSRKAELYADQLKKLKEKERELLNERKRLRE 170 667899******************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.314 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.87E-41 | 3 | 75 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-32 | 3 | 87 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.7E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.318 | 88 | 171 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 7.9E-21 | 89 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAIVFSQ SGRLHEYSSS 60 EMEKIIERYD KFTNALYVAE RPQVERYLQE LKMEMNRMVK KIDLLEVHHR KLLGKGLDSC 120 SVAELQEIDT QIEKSLLIVR SRKAELYADQ LKKLKEKERE LLNERKRLRE E |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 2e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 2e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 2e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 2e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.19277s0005.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY141220 | 0.0 | AY141220.1 Arabidopsis thaliana MADS-box protein AGL71 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020872013.1 | 1e-116 | MADS-box protein AGL71 isoform X2 | ||||
Swissprot | Q9LT93 | 1e-112 | AGL71_ARATH; MADS-box protein AGL71 | ||||
TrEMBL | D7MRJ8 | 1e-115 | D7MRJ8_ARALL; Predicted protein | ||||
STRING | Al_scaffold_0008_1558 | 1e-116 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.1 | 1e-101 | AGAMOUS-like 71 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.19277s0005.1.p |