PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.12795s0006.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 203aa MW: 23077.2 Da PI: 10.0596 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.3 | 5.4e-16 | 27 | 74 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd +l +++ +G g W+++a+ g++Rt+k+c++rw++yl Araha.12795s0006.1.p 27 KGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 74 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.8 | 4.6e-17 | 80 | 123 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++l++++ ++lG++ W++Ia++++ gRt++++k++w++ Araha.12795s0006.1.p 80 RGNITAEEQLLIIQLQAKLGNR-WSKIAKHLP-GRTDNEIKNFWRT 123 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.864 | 22 | 74 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.36E-29 | 25 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.4E-12 | 26 | 76 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-14 | 27 | 74 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-21 | 28 | 81 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.07E-8 | 29 | 74 | No hit | No description |
PROSITE profile | PS51294 | 24.084 | 75 | 129 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-15 | 79 | 127 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-15 | 80 | 123 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.1E-24 | 82 | 129 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.69E-12 | 84 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
METTMKKKGR GKATITSQKE EEGTVRKGPW TMEEDFILFN YILNHGEGLW NSVAKASGLK 60 RTGKSCRLRW LNYLRPDVRR GNITAEEQLL IIQLQAKLGN RWSKIAKHLP GRTDNEIKNF 120 WRTKIQRHMK VMSSEHMICS GNSQGSGMTT TDQGSSGKAI DMAESFSQAK TTFNVVEQSN 180 ENYWNVEDLW PVHLLNGDHH VI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-26 | 1 | 127 | 1 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00324 | DAP | Transfer from AT3G01530 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.12795s0006.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519582 | 0.0 | AY519582.1 Arabidopsis thaliana MYB transcription factor (At3g01530) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002882176.1 | 1e-149 | transcription factor MYB57 | ||||
Swissprot | Q9SSA1 | 1e-133 | MYB57_ARATH; Transcription factor MYB57 | ||||
TrEMBL | D7L9N9 | 1e-148 | D7L9N9_ARALL; Predicted protein | ||||
STRING | Al_scaffold_0003_59 | 1e-148 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01530.1 | 1e-135 | myb domain protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.12795s0006.1.p |