PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.12533s0002.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 129aa MW: 15003.1 Da PI: 8.8325 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 61.3 | 2.5e-19 | 14 | 83 | 2 | 71 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekk 71 F kkly++++d+++++++sws+ng+sf++++e ef ++vLp++ +++a F+R L gFkk++++e + Araha.12533s0002.1.p 14 FRKKLYKMVDDPSTNSIVSWSDNGKSFIIWNEPEFCRDVLPRFSHYKEMAPFIRRLGNMGFKKIESKELE 83 889***************************************9999******************998844 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 7.1E-24 | 7 | 95 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 4.2E-21 | 10 | 106 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 2.58E-22 | 11 | 95 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.8E-10 | 14 | 37 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.3E-18 | 14 | 95 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.8E-10 | 52 | 64 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.8E-10 | 65 | 77 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MDRDNNHKDR CLYFRKKLYK MVDDPSTNSI VSWSDNGKSF IIWNEPEFCR DVLPRFSHYK 60 EMAPFIRRLG NMGFKKIESK ELEYGSDDFV RGHPEPDLSP EAVRARLKEL ALASRKELCG 120 SKTLRSDV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5w_B | 1e-15 | 14 | 95 | 4 | 89 | Putative transcription factor |
5d5x_B | 1e-15 | 14 | 95 | 4 | 89 | Putative transcription factor |
5d5x_E | 1e-15 | 14 | 95 | 4 | 89 | Putative transcription factor |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.12533s0002.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB010695 | 1e-40 | AB010695.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDK4. | |||
GenBank | CP002688 | 1e-40 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001340391.1 | 1e-26 | heat stress transcription factor 29 | ||||
Refseq | XP_028191561.1 | 1e-26 | heat stress transcription factor A-4a-like | ||||
TrEMBL | D7MU83 | 6e-55 | D7MU83_ARALL; Uncharacterized protein | ||||
STRING | Bostr.3359s0057.1.p | 7e-57 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13231 | 11 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18870.1 | 1e-23 | HSF family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.12533s0002.1.p |