PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.0617s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 1667aa    MW: 187396 Da    PI: 5.0987
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.0617s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-181672157
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         ++kR   t+ qle+Le+ ++ ++yps++ r++L+ kl+L++rq ++WF+ rR k++k
  Araha.0617s0002.1.p 16 KSKRKMKTAAQLEVLENTYAAEPYPSEAIRADLSVKLNLSDRQLQMWFCHRRLKDRK 72
                         679****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-17372IPR009057Homeodomain-like
SuperFamilySSF466894.71E-151172IPR009057Homeodomain-like
PROSITE profilePS5007116.3421373IPR001356Homeobox domain
SMARTSM003891.7E-161577IPR001356Homeobox domain
CDDcd000861.52E-131673No hitNo description
PfamPF000468.4E-161672IPR001356Homeobox domain
SMARTSM005714.1E-23520579IPR018501DDT domain
PROSITE profilePS5082716.328520579IPR018501DDT domain
PfamPF027914.4E-17521576IPR018501DDT domain
PfamPF050661.1E-15702770IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.1E-6905943IPR028942WHIM1 domain
PfamPF156131.0E-1210781150IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1667 aa     Download sequence    Send to blast
MEGGSEKTTP EGGESKSKRK MKTAAQLEVL ENTYAAEPYP SEAIRADLSV KLNLSDRQLQ  60
MWFCHRRLKD RKSTTPSKRQ RKELVTPTAV ESSKPAVNAG DLVAGNELDS RRAARVGGGS  120
GGVTVVRRFN EPSSAEVRAI GYVEAQLGER LRDNGPILGM EFDPLPPGAF GMPIEMPSHR  180
KVTRQAFETN IYVRSDVKPI KDHVRPIREY QFIPELPSSR TDHSERVSPS HHFGVPLDGS  240
VMRASAVSAG HRDDYKISLQ IPNLNLATHQ GKPGHVYSPN LAEYDSPYQK SYVDTAAHGN  300
RNDHLIHEDP FVKPERDFGN EDEDDDALQL ERQRKNEEAR IAREVEAHEK RIRRELEKQD  360
MLRRKREEQI RKEMERQDRE RRKEEERLLR EKQREEERYL KEQMRELQRR EKFLKKETIR  420
AEKMRQKEEM RKEKEVARLK AANERAIARK IAKESMELIE DERLELMEVA ALTKGLPSML  480
ALDFETLQNL DEYRDKQVLF PPTSVRLKKP FAVKPWNGSD ENVANLLMVW RFLITFADVL  540
GLWPFTLDEF AQAFHDYDPR LMGEIHIVLL KTIIKDIEGV ARTLLTGVGA NQNTASNPGG  600
GHPHVVEGAY AWGFDIRSWR RNLNVFTWPE ILRQLALSAG LGPQLKKMNI KTLSVHDDNE  660
ANNSENVIVN LRKGVAAENA FAKMQERGLS NPRRSRHRLT PGTVKFAAFH VLSLEGEKGL  720
TILDVAEKIQ KSGLRDLTTS RTPEASVAAA LSRDTKLFER VAPSTYCVRA SYRKDAGDAE  780
TIFAEARERI RAFKSGVTDV EDVDDVERDE DSESDVGDDP EVDLNLKKED PNVLKIENLI  840
GVEPVLENGK LDTVPMKTEL GLPLTPSLPE DMKDEKRDDI LVEQSLEDAV ANGEDSACFD  900
ESKLGEQWVQ GLVEGDYSNL SSEERLNALV ALIGIAIEGN TIRIALEERL EVASALKKQM  960
WGEVQLDKRW KEESLIRANY LSYPTAKPGL NIATPASGNQ ESYSADVTPI SSQDPLSLPQ  1020
IDVNNVIAGP SLQLQENVPG MENLQYQQQQ GYTADRERLR AQLKAYIGYK AEELYVYRSL  1080
PLGQDRRRNR YWRFSASASR NDPGCGRIFV ELQDGRWRLI DSEEGFDYLV KSLDVRGVRE  1140
SHLHFMLLKI EASFKEAVRR SVEANPGLCS ISSSMDSDTG EISTTFKIEL GDSNAIERCS  1200
VLQRFHSFEK WMWDNMLHPG ALSAYKYGAK QSSPLFRICR ICAGLHFVGD ICCPSCGQMH  1260
AGPDIGELCF AEQVAQLGDI LRGGDIGFIL RSSISSPLRI RLLKVQLALV EASLPPEGLE  1320
AFWTENLRKS WGMKLMSSSS PEELNQVLTT LEAALKRDFL SSNFETTSEL LGLQVEALAS  1380
DFTCGVNVLP WIPKTTGGVA LRLFEFDSSI VYTPDQNKDP LKDKESEDFV GLETNFVRNV  1440
QEKDVMETPV QVAYTQEENW TDPGLGGVSS SGRGGRPPRG RGRPRSRGNG KKPAVSGRPP  1500
RGAANSNGET MLRPRAQPRG GRKNGRRIGT KGRKRPTKGT LGISNEVGGS RAKEVAVTAK  1560
TSLPDNDDDW IDTPELQDDD GEASSSGRSF QYEDYDDDVM APIDDFDGGG ESSKLVGRGE  1620
FSLHSDDEYE EEEEEEEEDM NMKMNVNVVD DEDEDYINDD SYGREQP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115211535RKNGRRIGTKGRKRP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.0617s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0428930.0AY042893.1 Arabidopsis thaliana Unknown protein (MLN1.10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020882322.10.0homeobox-DDT domain protein RLT2
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLD7MN210.0D7MN21_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.8__392__AT5G44180.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96012530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator