PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.0238s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 537aa    MW: 61186.6 Da    PI: 7.0322
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.0238s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.34.3e-1671156181
                          EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                          f kvlt sd++ +g + +p+k+a e+     ++++   ++l   d++g++ ++k++y+++++r++lt+GW+ F  +++L +gD+ +
  Araha.0238s0007.1.p  71 FTKVLTASDTSIHGGFFIPRKHAIECfppldMSQPLPAQELLTIDLHGNQRRFKHSYKGTPRRHLLTTGWNAFTTSKKLVAGDVKT 156
                          89****************************9666666679999****************************************944 PP

2Auxin_resp100.62e-33191270183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha++++++F vvY+Pr+  s+F+v+++k+++a+++k+ vG+Rf m+fe+ed+serr+sGt++gv+d++p +W +S+WrsL+
  Araha.0238s0007.1.p 191 AVHAFDNQCMFIVVYKPRS--SQFIVSYNKFLDAVNNKFNVGSRFTMRFEGEDFSERRYSGTIIGVNDFSP-HWMESEWRSLE 270
                          799***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.1E-2764176IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.02E-2568188IPR015300DNA-binding pseudobarrel domain
CDDcd100172.79E-1570165No hitNo description
SMARTSM010193.3E-1371167IPR003340B3 DNA binding domain
PfamPF023621.9E-1371154IPR003340B3 DNA binding domain
PfamPF065071.2E-29191269IPR010525Auxin response factor
PfamPF023091.5E-5416491IPR033389AUX/IAA domain
SuperFamilySSF542778.83E-9453531No hitNo description
PROSITE profilePS5174523.209455536IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
VEAYTREELN DEIQPIFYLP SKLQCRVFAI QLKVEKNSDE TYAEITLIPD TTQVVIPTQN  60
DNPYRPLVNS FTKVLTASDT SIHGGFFIPR KHAIECFPPL DMSQPLPAQE LLTIDLHGNQ  120
RRFKHSYKGT PRRHLLTTGW NAFTTSKKLV AGDVKTGELQ VGIRRARHQQ WNIPSILISI  180
DSMRHGVIAS AVHAFDNQCM FIVVYKPRSS QFIVSYNKFL DAVNNKFNVG SRFTMRFEGE  240
DFSERRYSGT IIGVNDFSPH WMESEWRSLE VKWDEFASFP RPDKVSPWEI EHLTPSLNVL  300
RPSLLKSKRS REVNEIGSTS SHLLHPILTQ GQEIEEPSMT SSMNVLLSYC DEIEDDETPS  360
KLLMGYHVPT MPKPNYNNDQ MVTPIEENTT TNASASFRLF GVSLPTSSVI KDPIEPMESY  420
PKSEISKLSQ EKKLSLGQTL TSPREIQSKQ FSSTRSCTKV QMQGVTVGRA LDLSVLNGYD  480
HLIIELEKLF DLNGQLQTRN QWEIAFKDNE GKKKLVGDNP WPEFCSMVKK IFIYPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A6e-97129352355Auxin response factor 1
4ldw_A6e-97129352355Auxin response factor 1
4ldw_B6e-97129352355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.0238s0007.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020887824.10.0auxin response factor 22
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7L9F70.0D7L9F7_ARALL; Auxin response factor
STRINGfgenesh1_pm.C_scaffold_30027200.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14