PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.0173s0016.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 275aa MW: 31355.2 Da PI: 8.1999 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 161.2 | 4e-50 | 19 | 142 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+ + +ekewyfF+ r +ky+++ r+nr+t sg+Wkatg dk+v Araha.0173s0016.1.p 19 PGFRFHPTDEELLGYYLRRKVENKTIKL-ELIKQIDIYKYDPWDLPRVSSVGEKEWYFFCMRGRKYRNSVRPNRVTGSGFWKATGIDKPV 107 9***************************.99***************7777799************************************* PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +s + vglkk+Lv+y g+a kg+ktdW+mhe+rl Araha.0173s0016.1.p 108 YS-NLDCVGLKKSLVYYLGSAGKGTKTDWMMHEFRL 142 **.9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 52.977 | 17 | 166 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.62E-55 | 18 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-25 | 19 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005992 | Biological Process | trehalose biosynthetic process | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006561 | Biological Process | proline biosynthetic process | ||||
GO:0009718 | Biological Process | anthocyanin-containing compound biosynthetic process | ||||
GO:0010120 | Biological Process | camalexin biosynthetic process | ||||
GO:0042538 | Biological Process | hyperosmotic salinity response | ||||
GO:1900056 | Biological Process | negative regulation of leaf senescence | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 275 aa Download sequence Send to blast |
MSGEGNLGKD HEEDEAPLPG FRFHPTDEEL LGYYLRRKVE NKTIKLELIK QIDIYKYDPW 60 DLPRVSSVGE KEWYFFCMRG RKYRNSVRPN RVTGSGFWKA TGIDKPVYSN LDCVGLKKSL 120 VYYLGSAGKG TKTDWMMHEF RLPTTTKTDS PAQQAEVWTL CRIFKRVTSQ RNPTIVPPNR 180 KPVITLTDSC SKTSSLDSDH TSHRIVDSLS HEPPLPQPQN PYWNQHMVGF NQPTYTCNDN 240 NNLLSFWNGN GGDFIGDSAS WDELRSVIDG NTKP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-53 | 19 | 172 | 19 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-53 | 19 | 172 | 19 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-53 | 19 | 172 | 19 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-53 | 19 | 172 | 19 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-53 | 19 | 172 | 22 | 174 | NAC domain-containing protein 19 |
3swm_B | 5e-53 | 19 | 172 | 22 | 174 | NAC domain-containing protein 19 |
3swm_C | 5e-53 | 19 | 172 | 22 | 174 | NAC domain-containing protein 19 |
3swm_D | 5e-53 | 19 | 172 | 22 | 174 | NAC domain-containing protein 19 |
3swp_A | 5e-53 | 19 | 172 | 22 | 174 | NAC domain-containing protein 19 |
3swp_B | 5e-53 | 19 | 172 | 22 | 174 | NAC domain-containing protein 19 |
3swp_C | 5e-53 | 19 | 172 | 22 | 174 | NAC domain-containing protein 19 |
3swp_D | 5e-53 | 19 | 172 | 22 | 174 | NAC domain-containing protein 19 |
4dul_A | 4e-53 | 19 | 172 | 19 | 171 | NAC domain-containing protein 19 |
4dul_B | 4e-53 | 19 | 172 | 19 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00310 | DAP | Transfer from AT2G43000 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.0173s0016.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493587 | 0.0 | AB493587.1 Arabidopsis thaliana At2g43000 mRNA for hypothetical protein, partial cds, clone: RAAt2g43000. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002881884.1 | 0.0 | transcription factor JUNGBRUNNEN 1 | ||||
Swissprot | Q9SK55 | 0.0 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | D7LJF2 | 0.0 | D7LJF2_ARALL; ANAC042 | ||||
STRING | fgenesh2_kg.4__2460__AT2G43000.1 | 0.0 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM306 | 28 | 200 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 0.0 | NAC domain containing protein 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.0173s0016.1.p |