PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.YX0HY | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 139aa MW: 16715.1 Da PI: 9.6705 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 32 | 2e-10 | 65 | 100 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+++gL+++q+ +WF N+R ++ Aradu.YX0HY 65 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 100 5679*****************************985 PP | |||||||
2 | ELK | 39.7 | 1e-13 | 20 | 41 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++LlrKYsgyL+sLkqE+s Aradu.YX0HY 20 ELKNHLLRKYSGYLSSLKQELS 41 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 3.5E-7 | 20 | 41 | IPR005539 | ELK domain |
Pfam | PF03789 | 6.9E-11 | 20 | 41 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 11.296 | 20 | 40 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.989 | 40 | 103 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.69E-20 | 41 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 2.1E-13 | 42 | 107 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.5E-28 | 45 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 9.71E-12 | 52 | 104 | No hit | No description |
Pfam | PF05920 | 2.2E-17 | 60 | 99 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 78 | 101 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MWVEGDTEVA EIDPRAEDRE LKNHLLRKYS GYLSSLKQEL SKKKKKGKLP KDARQKLLNW 60 WELHYKWPYP SESEKVALAE STGLDQKQIN NWFINQRKRH WKPSEDMQFM VMDGLHAHQK 120 QTLYMDPHYL PDPHYRLAP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably binds to the DNA sequence 5'-TGAC-3'. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.YX0HY |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM107002 | 2e-94 | HM107002.1 Glycine max KNOX-like DNA-binding protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015972542.1 | 4e-96 | homeotic protein knotted-1 | ||||
Refseq | XP_025606784.1 | 5e-96 | homeotic protein knotted-1 | ||||
Swissprot | O04135 | 4e-75 | KNAP2_MALDO; Homeobox protein knotted-1-like 2 | ||||
TrEMBL | A0A444YVW8 | 1e-94 | A0A444YVW8_ARAHY; Uncharacterized protein | ||||
STRING | XP_004291007.1 | 1e-74 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4584 | 32 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 5e-65 | KNOTTED-like from Arabidopsis thaliana |