PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.WAU1C | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 114aa MW: 12952.2 Da PI: 8.7514 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 47.4 | 3.4e-15 | 50 | 112 | 35 | 99 |
EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 +++l+ +sW ++iy+ +s+ +++ +GW++F++a +L++gD++vF+l+++++ + v+++r+ Aradu.WAU1C 50 DVKLQ-FGKKSWPATIIYNPSSKNTFILAGWNSFARASKLEAGDVCVFELVNKKDL-FDVHICRA 112 55543.3669**************99999*********************986444.69999997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01019 | 4.0E-10 | 21 | 113 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 5.3E-15 | 35 | 113 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 1.24E-13 | 37 | 112 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 7.76E-15 | 41 | 111 | No hit | No description |
Pfam | PF02362 | 5.4E-13 | 48 | 112 | IPR003340 | B3 DNA binding domain |
PROSITE profile | PS50863 | 11.166 | 58 | 113 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MTKHNMPCKL LSASLYLVLQ IFITIFDHTD SKMGCDAVFI SYLLQKNQQD VKLQFGKKSW 60 PATIIYNPSS KNTFILAGWN SFARASKLEA GDVCVFELVN KKDLFDVHIC RAQC |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.WAU1C |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016182534.1 | 8e-41 | B3 domain-containing protein LOC_Os12g40080-like | ||||
Refseq | XP_025624966.1 | 6e-41 | B3 domain-containing transcription factor VRN1 isoform X1 | ||||
Refseq | XP_025624967.1 | 2e-41 | B3 domain-containing protein Os12g0591400 isoform X2 | ||||
Refseq | XP_025681366.1 | 8e-41 | B3 domain-containing protein LOC_Os12g40080 | ||||
TrEMBL | A0A444ZSV6 | 7e-50 | A0A444ZSV6_ARAHY; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15597 | 2 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G49480.1 | 2e-07 | related to vernalization1 1 |