PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.S93F6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 95aa MW: 11021.9 Da PI: 11.0178 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 162.6 | 2.5e-50 | 2 | 75 | 1 | 74 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgsk 74 ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrk ++ Aradu.S93F6 2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKVTN 75 5899******************************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 1.6E-47 | 3 | 76 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNF KLPKHCDNNE VLKALCNEAG 60 WTVEPDGTTY RKVTNLTPLK RVPVILFYLI GIMVS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May function in brassinosteroid signaling. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.S93F6 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016702634.1 | 1e-46 | PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 | ||||
Refseq | XP_016702636.1 | 1e-46 | PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 | ||||
Swissprot | Q5Z9E5 | 1e-28 | BZR3_ORYSJ; Protein BZR1 homolog 3 | ||||
TrEMBL | A0A1U8KJC4 | 2e-45 | A0A1U8KJC4_GOSHI; BES1/BZR1 homolog protein 4-like isoform X1 | ||||
TrEMBL | A0A2P5WYB4 | 6e-46 | A0A2P5WYB4_GOSBA; Uncharacterized protein | ||||
STRING | XP_010675300.1 | 2e-40 | (Beta vulgaris) | ||||
STRING | XP_009352718.1 | 7e-40 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15152 | 11 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G78700.1 | 1e-28 | BES1/BZR1 homolog 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|