PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.N6RAF | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 165aa MW: 17083.6 Da PI: 10.3941 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 126.6 | 7.5e-40 | 39 | 95 | 5 | 61 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 alkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk Aradu.N6RAF 39 ALKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKL 95 789***************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 9.0E-24 | 38 | 89 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 6.8E-34 | 39 | 94 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.432 | 40 | 94 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 42 | 78 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010052 | Biological Process | guard cell differentiation | ||||
GO:0010118 | Biological Process | stomatal movement | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1902066 | Biological Process | regulation of cell wall pectin metabolic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MIKEQGGGGG GGGSKKSTTS GSSATTSSQQ QEQQASVAAL KCPRCDSPNT KFCYYNNYSL 60 TQPRHFCKTC RRYWTKGGAL RNVPIGGGCR KNKKLNKSSR LLSSPSSDSP GVGSSSDLAV 120 LGGGLKFLHG LASSVPVPPS LDFHLGAAAA ALPLTLILII LLLSV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.N6RAF |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015963096.2 | 1e-108 | LOW QUALITY PROTEIN: dof zinc finger protein DOF5.7-like | ||||
Swissprot | O82155 | 7e-36 | DOF17_ARATH; Dof zinc finger protein DOF1.7 | ||||
Swissprot | Q9LSL6 | 5e-35 | DOF57_ARATH; Dof zinc finger protein DOF5.7 | ||||
TrEMBL | A0A444WVV0 | 1e-105 | A0A444WVV0_ARAHY; Uncharacterized protein | ||||
STRING | Gorai.003G036800.1 | 2e-52 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3854 | 34 | 60 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37590.1 | 1e-31 | DNA binding with one finger 2.4 |
Publications ? help Back to Top | |||
---|---|---|---|
|