PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.H4JTY | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 137aa MW: 15314.1 Da PI: 5.4506 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 39.5 | 2e-12 | 1 | 65 | 31 | 90 |
YABBY 31 lfkvvtvrCGhCtsllsvnlakas....qllaaeshlde.slkeelleelkveeenlksnvekee 90 +++vvtvrCGhCtsllsvn++kas +lla+ s ++ + kee ++++ +++ ++++++++ Aradu.H4JTY 1 MSMVVTVRCGHCTSLLSVNMMKASfvplHLLASLSTHHHhHSKEEDANNNIAMNSSSSMMMINYS 65 579*******************9977877777766433303333333333333333333333333 PP | |||||||
2 | YABBY | 54 | 7.2e-17 | 77 | 116 | 129 | 168 |
YABBY 129 ynrfikeeiqrikasnPdishreafsaaaknWahfPkihf 168 n + +i+r+ka+nP+++h+eafs+aaknWa fP+ f Aradu.H4JTY 77 INNVVNKQIKRLKAENPEMAHKEAFSTAAKNWANFPPTQF 116 5888999*****************************9887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.7E-24 | 1 | 117 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MSMVVTVRCG HCTSLLSVNM MKASFVPLHL LASLSTHHHH HSKEEDANNN IAMNSSSSMM 60 MINYSSDDCA EEDVTTINNV VNKQIKRLKA ENPEMAHKEA FSTAAKNWAN FPPTQFNGDE 120 EICNQKEQFA DLDSQVD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Essential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:9093862, ECO:0000269|PubMed:9118807}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.H4JTY |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:12183381}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016200725.1 | 2e-80 | axial regulator YABBY 4 | ||||
Refseq | XP_025650841.1 | 2e-80 | axial regulator YABBY 4 | ||||
Swissprot | Q9LDT3 | 1e-27 | YAB4_ARATH; Axial regulator YABBY 4 | ||||
TrEMBL | A0A444Z6X5 | 8e-80 | A0A444Z6X5_ARAHY; Uncharacterized protein | ||||
STRING | AES96167 | 8e-56 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6144 | 28 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23420.1 | 2e-26 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|