PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aradu.H2R03

Organism

Arachis duranensis

Taxonomic ID

130453

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

MIKC_MADS

Protein Properties

Length: 235aa MW: 27013.6 Da PI: 8.7673

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aradu.H2R03	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.4	1.4e-31	33	82	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Aradu.H2R03 33 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 82 79***********************************************8 PP
2	K-box	20	2.9e-08	100	134	3	37
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRh 37 +s+g s++e +a+++qqe+akL+ +i+nLq+ +R+ Aradu.H2R03 100 SSNGGSTSEINAQHYQQESAKLRVQISNLQNHNRQ 134 4556669999********************99996 PP
3	K-box	25.4	5.8e-10	132	165	67	100
K-box 67 skKnellleqieelqkkekelqeenkaLrkklee 100 +++nell+++i+++qk+e +l+++n+ Lr+k++e Aradu.H2R03 132 NRQNELLFAEIDYMQKREVDLHNNNQFLRAKIAE 165 69*****************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	34.132	25	85	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.1E-42	25	84	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.60E-46	26	102	No hit	No description
SuperFamily	SSF55455	5.76E-33	26	98	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	27	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.0E-33	27	47	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.5E-27	34	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.0E-33	47	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.0E-33	62	83	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 235 aa Download sequence Send to blast
MDFPNHHHQE SMSDSCSQQK KNNNMGRGKI EIKRIENTTN RQVTFCKRRN GLLKKAYELS 60 VLCDAEVALI VFSSRGRLYE YANNSVKASI ERYKKASSDS SNGGSTSEIN AQHYQQESAK 120 LRVQISNLQN HNRQNELLFA EIDYMQKREV DLHNNNQFLR AKIAESERNQ HSNNNNNNVL 180 SGGGTNYNNN ESHHNEQHQF ESRGYFQVTA LQPNNNENHY AATAARQDHM SLQLV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
1tqe_R	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
1tqe_S	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
5f28_A	1e-21	25	93	1	69	MEF2C
5f28_B	1e-21	25	93	1	69	MEF2C
5f28_C	1e-21	25	93	1	69	MEF2C
5f28_D	1e-21	25	93	1	69	MEF2C
6byy_A	2e-21	25	97	1	73	MEF2 CHIMERA
6byy_B	2e-21	25	97	1	73	MEF2 CHIMERA
6byy_C	2e-21	25	97	1	73	MEF2 CHIMERA
6byy_D	2e-21	25	97	1	73	MEF2 CHIMERA
6c9l_A	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
6c9l_B	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
6c9l_C	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
6c9l_D	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
6c9l_E	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
6c9l_F	1e-21	25	97	1	73	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:19956801}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Aradu.H2R03

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269\|PubMed:10198637, ECO:0000269\|PubMed:11058164, ECO:0000269\|PubMed:1675158, ECO:0000269\|PubMed:17794879, ECO:0000269\|PubMed:18281509, ECO:0000269\|PubMed:19783648, ECO:0000269\|PubMed:9783581}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015958103.1	1e-162	floral homeotic protein AGAMOUS
Refseq	XP_025640343.1	1e-162	floral homeotic protein AGAMOUS
Swissprot	P17839	5e-97	AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBL	A0A0S3QZ09	1e-105	A0A0S3QZ09_PHAAN; Uncharacterized protein
TrEMBL	A0A3Q0F401	1e-105	A0A3Q0F401_VIGRR; floral homeotic protein AGAMOUS-like isoform X2
STRING	XP_004504255.1	6e-99	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF684	29	102

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	2e-89	MIKC_MADS family protein

Publications ? help Back to Top
Huang Z, et al. APETALA2 antagonizes the transcriptional activity of AGAMOUS in regulating floral stem cells in Arabidopsis thaliana. New Phytol., 2017. 215(3): p. 1197-1209 [PMID:27604611] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Uemura A, et al. Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis. Plant Reprod, 2018. 31(1): p. 89-105 [PMID:29218596]