PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.44JDK | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 217aa MW: 25009.7 Da PI: 9.1334 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.8 | 3.3e-29 | 14 | 64 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr g+lKKA+ELSvLCda++a+iifs++g+l+eyss Aradu.44JDK 14 KRIENATSRQVTFSKRRSGLLKKAHELSVLCDAQIALIIFSQSGRLFEYSS 64 79***********************************************96 PP | |||||||
2 | K-box | 67.5 | 4.5e-23 | 99 | 174 | 22 | 97 |
K-box 22 akLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 L k+ie L+ +qR+l+G++L+s+s+ eL +e+qL +sl++iR kK +l++e+ie+lq+kek+l en +L+++ Aradu.44JDK 99 PSLAKKIELLELSQRKLMGQGLSSCSFDELVGIENQLVSSLQNIRLKKAQLYREHIEQLQNKEKDLLLENAKLTEM 174 5799********************************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.3E-41 | 6 | 65 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.015 | 6 | 66 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.06E-32 | 8 | 83 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 8 | 62 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-30 | 8 | 28 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.57E-42 | 8 | 82 | No hit | No description |
Pfam | PF00319 | 2.0E-25 | 15 | 62 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-30 | 28 | 43 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-30 | 43 | 64 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.885 | 91 | 181 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.0E-20 | 99 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MEKKKMVRGK IEMKRIENAT SRQVTFSKRR SGLLKKAHEL SVLCDAQIAL IIFSQSGRLF 60 EYSSTSDMDQ LLERYRQYVA DDGRINNIGE FQQLEFDPPS LAKKIELLEL SQRKLMGQGL 120 SSCSFDELVG IENQLVSSLQ NIRLKKAQLY REHIEQLQNK EKDLLLENAK LTEMCVQRKK 180 SEEQWGKQRG ATLSPSPSNQ SSVLVETELF IGLPEWR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_B | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_I | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_J | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_A | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_B | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_C | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_D | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_I | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_J | 2e-22 | 8 | 78 | 2 | 71 | Myocyte-specific enhancer factor 2A |
5f28_A | 1e-22 | 6 | 78 | 1 | 72 | MEF2C |
5f28_B | 1e-22 | 6 | 78 | 1 | 72 | MEF2C |
5f28_C | 1e-22 | 6 | 78 | 1 | 72 | MEF2C |
5f28_D | 1e-22 | 6 | 78 | 1 | 72 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.44JDK |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015967280.1 | 1e-154 | MADS-box protein AGL42-like | ||||
Refseq | XP_020999117.1 | 1e-154 | MADS-box protein AGL42-like | ||||
Refseq | XP_020999118.1 | 1e-154 | MADS-box protein AGL42-like | ||||
Swissprot | Q9FIS1 | 7e-65 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A445CZV5 | 1e-131 | A0A445CZV5_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA10G38541.1 | 2e-75 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 3e-67 | AGAMOUS-like 42 |