PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G175100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family Nin-like
Protein Properties Length: 328aa    MW: 37280.2 Da    PI: 9.7649
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G175100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.15.5e-26206255352
             RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +ei l+dl kyF+lpi++A+k L+v+lTvLKr+CR++GI+RWPhRkiksl
  Aqcoe6G175100.1.p 206 AEIALDDLVKYFDLPITEASKILKVGLTVLKRKCRELGIPRWPHRKIKSL 255
                        789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.27191275IPR003035RWP-RK domain
PfamPF020424.6E-21208255IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MESSKAPVLS ALGVFKNVIN EELIRSLHVY QLEDGNEIGV EREFLFSTTS SYVEMIAQPV  60
LKLSKVKMSE LYEGQMMGIW FCMLVFNICA PSRLTPIPPI LLISRNPKLK SIPTLVDDLQ  120
KVFQLTYGAK NKQPAVIEDT SGGEVNSDNC PTERVFSVLD QDLNCLPNAT GVPPSAEKQK  180
SVQSPTDDAQ KKTKNTRKKA VSERIAEIAL DDLVKYFDLP ITEASKILKV GLTVLKRKCR  240
ELGIPRWPHR KIKSLDTLIH DLQEEAERQE RENEVAAMAV NKRKRMLENE KESIARKPFM  300
DIQSETKRFR QDVFKRRHRA RNLKNKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020532738.11e-128protein RKD5
TrEMBLA0A2G5DTA20.0A0A2G5DTA2_AQUCA; Uncharacterized protein
STRINGAquca_015_00350.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-82RWP-RK domain-containing protein