PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G066000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family Nin-like
Protein Properties Length: 999aa    MW: 110831 Da    PI: 5.667
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G066000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.45.9e-28592643152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek+isl++l++yF+ ++kdAAk+Lgvc+T++KriCR++GI+RWP+Rki+++
  Aqcoe6G066000.1.p 592 AEKSISLDVLQQYFAVSLKDAAKSLGVCPTTMKRICRNHGISRWPSRKINKV 643
                        589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.348582663IPR003035RWP-RK domain
PfamPF020422.6E-25596643IPR003035RWP-RK domain
SuperFamilySSF542772.16E-20898987No hitNo description
SMARTSM006662.3E-19903985IPR000270PB1 domain
PROSITE profilePS5174519.398903985IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2409.4E-20904984No hitNo description
PfamPF005641.0E-14905984IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 999 aa     Download sequence    Send to blast
MYEAEEENSS IDSKTSSTLP LSSTVEQQYS SLMDFDFDID SSWPFDRNIF TSNPSSPNYL  60
LSLASSPLRN PTFSEHQSFP NWVFLDEDDE KSSFKANSLS NCNTINGNSV RDKNKRKFLP  120
ASVGMLPVEM QDGSSVIKEK MLQALQHFKE SMDQHILAQI WAPVKKGDHY VLTTSGQPFV  180
LDPQSNGLLQ YRTVSLMYMF SLEGESDGEL GLPGRVFRQK LPEWTPDVQY YSSKEYPRLN  240
HALCYNVRGT LALPVFEPSK QSCLGVIELI MMSQKINYAP EVDKVCKALE AVNLKSSDSL  300
DHPSFQICND GRQYALAEIL EILTVVCETH RLPLAQTWVP CQHRKILADG GGVEKSCMSF  360
DGSCMGQVCM STTDVAFYVV DAHMWGFRDA CSEHHLQKGQ GVAGRAFSSK GSCFSMDITQ  420
FSKTQYPLAH YAQMFGLSSC FAICLCSTHT GTDDYILEFF LPPGIMDLSE QLTFVNSVLA  480
TMKHHCRSLK VASKDELGEE KPVEIIETST DKNLDLRFKS TQTSSQIKSP GEPNSLSNQG  540
CTQKTDLFEK QSMVEMGDPR NGDNAVSMST NHTTLSGNKG MKKTLEKKKG KAEKSISLDV  600
LQQYFAVSLK DAAKSLGVCP TTMKRICRNH GISRWPSRKI NKVNHSISKL NRVIESVQGA  660
ERAFDLTSFN TSPGPIFVGS LSWPVCLNGP KEQHSTDPNL FEFQRGKETN LSTRTEPETY  720
DGKIGIKILE MDDLSTHQEQ FLNPGGLHSE LGKGSSFMKI RSGSGEESTE TPTSHGSCQG  780
SPINETTITN DVFISSVQGP GESNRSFLGV KPQPSEQLNI FSSHSTPEAP FMTQQPPLGG  840
MLIEDAGSSK DLRKLSNLVS ELEEWELESN SKNHVCPGNV PPEGMNPNGH TMPHITAAED  900
TKILTFKVNY QDDIIRFRLP VTSGMHELMG EVAKRFKLEV GTFSMKYLDD DHEWVSLACD  960
TDWQECMDNS GLSGKRVTRL MVHEIIADLG SSCESLRG*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267558.10.0PREDICTED: protein NLP6-like isoform X2
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A2G5E7U00.0A0A2G5E7U0_AQUCA; Uncharacterized protein
STRINGAquca_010_00024.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7