PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G120800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family Nin-like
Protein Properties Length: 338aa    MW: 38723.2 Da    PI: 5.8406
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G120800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK59.18.1e-19196245352
             RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        k++s++d+skyF+lpi++A+ +L++++ +L ++C  +GI  WP+Rkiksl
  Aqcoe5G120800.1.p 196 KDLSFDDISKYFDLPITEACACLNIGQKLLTKKCKDFGILNWPYRKIKSL 245
                        79**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.22177265IPR003035RWP-RK domain
PfamPF020422.1E-14198245IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MNDEIFIIYV HTYDIYSLRM SISGGEQMES HIVTGRMYQG ESSSNQSKGK SPVLALYQNW  60
SSDLSYDLDE PKPEVDAPAL IAMEFSICEI KSKSLDLNWP PLEGDTYEVI ENQPITSAMM  120
EDQLKSSLTE NWQTPAGTGI GPTMQAQASL LVDVNIYDYN PLTENQQTLA GIDIQSTGPK  180
FAPGKRHPEW YKNYVKDLSF DDISKYFDLP ITEACACLNI GQKLLTKKCK DFGILNWPYR  240
KIKSLDNLIR NIKEDVERQE PLDKTFMDEA LKMLQIIEHE KEFLKKRPVF QIKGETKKLR  300
QYFFGRNYDI KRAKKAKLIK EQSDPEMKRK GKQSLSA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1324332PEMKRKGKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-25RWP-RK domain-containing protein