PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe4G078600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HB-other
Protein Properties Length: 1798aa    MW: 200103 Da    PI: 5.0349
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe4G078600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.25.2e-173792257
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
           Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        kR   ++ qle+Le+ +  + yps++ r+eL+ klgLt+rq ++WF+ rR k++k
  Aqcoe4G078600.1.p 37 PKRKMKSAAQLEVLEKTYLLETYPSEALRAELSVKLGLTDRQLQMWFCHRRLKDRK 92
                       689999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-16993IPR009057Homeodomain-like
SuperFamilySSF466899.84E-162194IPR009057Homeodomain-like
PROSITE profilePS5007116.0343393IPR001356Homeobox domain
SMARTSM003892.5E-163597IPR001356Homeobox domain
PfamPF000461.3E-143792IPR001356Homeobox domain
CDDcd000868.38E-133894No hitNo description
PROSITE profilePS5082717.417568627IPR018501DDT domain
SMARTSM005715.2E-20568627IPR018501DDT domain
PfamPF027914.5E-17569624IPR018501DDT domain
PfamPF050662.0E-14756824IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156124.1E-89751017IPR028942WHIM1 domain
PfamPF156138.8E-1211561226IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1798 aa     Download sequence    Send to blast
MESTTPDTMK KASASSSVDG AGGGGNGGGG SGGEAKPKRK MKSAAQLEVL EKTYLLETYP  60
SEALRAELSV KLGLTDRQLQ MWFCHRRLKD RKVQPMKKQK KESISSPVMV PVSGVGYDDI  120
SMGNEGGIGG GGGGGSGSGS GSSPFEPRKV VARATAAVSR IGADMPMVKR YYEPVMQPSL  180
EIRAIAFVEK QLGQHIRDDG PILGMEFDPL PPGAFGAPIA MTGQQKPAGR PYDGKMYERR  240
ESKAIKTSLR APHEYQFLPE QPSVRSEYGR GDPSHYYNSG TEVPSGRVSY STGAPYLHGK  300
EPVADYGFQG QLPSGSHPQQ GRAGHVFSSA SGEYESPHRS PFTNIGMESQ VASHPAVGLE  360
DPFLPDRQVS QEEEAVRVER KRKNDEARIA REVEAHEKRI RKELEKQDIL RRKREEQMRK  420
EMEKHDRERR KEEERLMREK LREEERFQRE QRRELERRER FLQKENLRAE KMRQKEELRK  480
EKEAARLKAA NERATARRIA KESMELIEDE RLELMDLAVA QKGLPSILSL DSDTLQNLDI  540
FRDMLSTFPP KSVKLKRPIT IRPWIDSEEN MGNLLMVYKF LITFAEVLDI WPFTLDEFIQ  600
AMHDYEPRML GEIHVALLRS IIKDIEDVAR TPSIGLGANQ NSAASPGGGH PQIVEGVAHF  660
LSAYAWGFDI RCWQRHLNPV TWPEILRQFA LSAGFGPQLK KRSPERAYYR DDNEGHDGED  720
IVCTLRNGVA AENALAVMQE KGFSQPRKSR HRLTPGTVKF AAFHVLSLEG SKGLTILEVA  780
DKIQKSGLRD LTTSKTPEAS IAAALSRDGN LFERTAPSTY CVKSAFRKDP ADAEALLSAA  840
REKIQIFENG FSDSEGEKDA DNNVVKDEDS DCDPVEDAED DDVGVAANLD EGVSHSKETK  900
SSQSIACSGN GENTPLFVTP QNGVVKDLAP FLVEGAKEVN STGSTFGQSI DNAVNCNNSS  960
NHQQEDTEID ENNSGEPWVV GLTEGEYSEL SVEERLNALV ALVGVAIEGN SIRVILEERL  1020
EAANALKKQM WAEAQLDKRR MKEDYVTKFQ YPSYTGIKTD PSPMNATVDG NQSPYAGDNK  1080
TNDASLNPTV KQEPVLELHN AQNNLNNLPT ERNLVGQELS MAPESLAQSN AFAAERSRVQ  1140
LKSYIGHKAE EMYVYRSLPL GQDRRRNRYW QFVTTATKYD PGSSRIFFES QGGCWRLIDS  1200
EEGFDALLAS LDTRGIREAH LHSMLLNVET SFKEAVRSCK KSSNYADPDR VMTTPNVSGV  1260
MLSPDCKAGI ASPSSTLCGV SVDTQDQSSS FKVELGKTQD EIKNTLIRYQ EFQDWMWKEW  1320
FHPSIFCAMK FGKKRCPELL VTCEFCHDSY FSEDNHCHVC HMTFGSFYNN SDFSDHVNLC  1380
EEKQKTGSIN RCSNSSVPLR IRLLKSQLAL VEAHIPPEAL QPLWTEDYRK SWGIKLQASS  1440
SAEELLQFVT ILEGAVKNDY LASNFETTKE LLVMTRGFTV DNSYATLPEE VPVLPWVPLT  1500
TAAVALRFME IDASISYMLQ QKVESQKDKE ASEFIKLPSR YTVAKNVQEL EQGVLDQSNH  1560
LQEDEDNWVS VGSGPNSSVR GRGLRGRGRS HNRGGRKLQR RGSGSTGGVG KKIQTRGRGR  1620
RRGRRSVRNR QISGKRIVGT GMDLGPRGVN ILPKQNTIVL PPRTSTGMDW ERDIRGLHVE  1680
DDDISNTAEA SESDDNGQAS GDEYDDQGAG YGGMFHHKSE DYMESDEEGD EEGDEDDDVD  1740
GVGDGYEEGD VDGEDDGEME LDGAQMGSEY GEEDEDDLEG NEEDEDRTSS ASSDYSQ*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260331.10.0PREDICTED: homeobox-DDT domain protein RLT2 isoform X2
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A2G5CIV80.0A0A2G5CIV8_AQUCA; Uncharacterized protein
STRINGAquca_051_00028.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator