PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aqcoe4G024000.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 273aa MW: 30757.1 Da PI: 9.041 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.3 | 6.4e-31 | 40 | 90 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLC+aeva+i+fss+g+lyeys+ Aqcoe4G024000.1.p 40 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYSN 90 79***********************************************95 PP | |||||||
2 | K-box | 104.1 | 1.7e-34 | 109 | 203 | 5 | 99 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 ++ s++ea+a+ +qqe++kL ++i +Lq+ +R+l+Ge+L++L+++eL+q+e+++e +++kiR+kKnell+++ie++qk+e +lq +nk+Lr+ Aqcoe4G024000.1.p 109 NSGSVSEANAQFYQQEATKLCNQIASLQNHNRKLVGESLSNLNIRELKQIEKKIEGGISKIRAKKNELLFAEIEYMQKRELDLQTDNKYLRA 200 33449**************************************************************************************9 PP K-box 97 kle 99 +++ Aqcoe4G024000.1.p 201 MIA 203 987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.613 | 32 | 92 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.8E-41 | 32 | 91 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.68E-45 | 33 | 107 | No hit | No description |
SuperFamily | SSF55455 | 8.11E-33 | 33 | 106 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 34 | 88 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-32 | 34 | 54 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.7E-26 | 41 | 88 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-32 | 54 | 69 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-32 | 69 | 90 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.7E-25 | 116 | 202 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.076 | 118 | 208 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 273 aa Download sequence Send to blast |
MPHPSHTSIG NGCLITDFPS LAIAGDSPQR KMGRGKIEIK RIENTTNRQV TFCKRRNGLL 60 KKAYELSVLC EAEVALIVFS SRGRLYEYSN NSVKKTIERY KKACTDSTNS GSVSEANAQF 120 YQQEATKLCN QIASLQNHNR KLVGESLSNL NIRELKQIEK KIEGGISKIR AKKNELLFAE 180 IEYMQKRELD LQTDNKYLRA MIAANERAPE HMNLMPANEY HALSSAPFDS RNFMPANLLD 240 HNNNYSRSDQ TTLQLGFCES FCCPLSLSLP IL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 4e-20 | 32 | 100 | 1 | 69 | MEF2C |
5f28_B | 4e-20 | 32 | 100 | 1 | 69 | MEF2C |
5f28_C | 4e-20 | 32 | 100 | 1 | 69 | MEF2C |
5f28_D | 4e-20 | 32 | 100 | 1 | 69 | MEF2C |
6c9l_A | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-20 | 32 | 100 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY464111 | 0.0 | AY464111.1 Aquilegia alpina AGAMOUS-like protein mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010656928.1 | 1e-122 | PREDICTED: MAD-box transcripion factor isoform X2 | ||||
Refseq | XP_019078770.1 | 1e-122 | PREDICTED: MAD-box transcripion factor isoform X3 | ||||
Swissprot | Q93XH4 | 1e-120 | MADS1_VITVI; Agamous-like MADS-box protein MADS1 | ||||
TrEMBL | A0A2G5C119 | 0.0 | A0A2G5C119_AQUCA; Uncharacterized protein | ||||
STRING | Aquca_136_00009.1 | 0.0 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 7e-99 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aqcoe4G024000.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|