PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G415000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family Nin-like
Protein Properties Length: 294aa    MW: 32068.7 Da    PI: 8.08
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G415000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK67.81.6e-212267348
             RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48
                       ++++++ +sk+F++pi+dAA +Lgvc +vLK+iCR +G+ RWP+Rk
  Aqcoe3G415000.1.p 22 ESLTFDGISKFFNMPIADAATNLGVCSSVLKKICRDNGLVRWPYRK 67
                       689******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.221791IPR003035RWP-RK domain
PfamPF020427.6E-192368IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTTMSSSSTT TTQTTVTTTT IESLTFDGIS KFFNMPIADA ATNLGVCSSV LKKICRDNGL  60
VRWPYRKFLA GKSVEEIQKD AARERRREMI ELARAARQKD AATTSLYATT TILGQQGNNL  120
SQDGWQQGNN PSRDGGKQGS NPSQEGLSND MLYSGSARNL LAHLDEFKEG FPSNGLSTVT  180
MRWWGDHTSD ANDDEMLGEE SAIDGTNKQQ SHNAANKCME GKSDTTSEKS NIVPQGTALL  240
LSVRESAAAE GREALKLGVH GGYRSFKLNR REKMLLHKVF DSSLPSQWKI NSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241339.11e-84PREDICTED: uncharacterized protein LOC104585973 isoform X1
TrEMBLA0A2G5CH050.0A0A2G5CH05_AQUCA; Uncharacterized protein
STRINGAquca_057_00077.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.26e-10Nin-like family protein