PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G339800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family Nin-like
Protein Properties Length: 339aa    MW: 38764 Da    PI: 4.7975
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G339800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.21.2e-26168217352
             RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         e++ +++++yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Aqcoe3G339800.1.p 168 TELTRKTIAQYFYMPITQAAKELNVGLTLLKKRCRELGIPRWPHRKLMSL 217
                        6899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.03153237IPR003035RWP-RK domain
PfamPF020422.1E-22170217IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDQKHTSVQN ISFSTTTSHG FETVSNLFEE DPFFMSQKIH PLDFSGDSNF NYPWEFPMQD  60
DNVLDAIPLM ECLPTDPLLY ASLDASLDII PSENSTTNCQ GDLYKRWEEE FGAFDEMSVC  120
QFESDNKQIV LYDNGDQMSS NNSGDGVWND QKKVNRCSER KITNTSSTEL TRKTIAQYFY  180
MPITQAAKEL NVGLTLLKKR CRELGIPRWP HRKLMSLQTL IKNVQEMEDG DAGDTKIRDA  240
IELLEQQKKL MEEMPEVELE EKTKKLRQAC FKANYKKRKL MGMIEWPSSP NSHLSIESME  300
TSTAASNKRL GFWKCTFFIL VCCIGVCNSS LTSLFQTM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258431.11e-75PREDICTED: protein RKD1-like
TrEMBLA0A1U8AA293e-74A0A1U8AA29_NELNU; protein RKD1-like
STRINGXP_010258431.16e-75(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-39RWP-RK domain-containing protein