PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aqcoe3G017500.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 117aa MW: 12721.4 Da PI: 8.3219 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 52.2 | 8.5e-17 | 53 | 86 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 Cs C+ttkT+lWR gp g+ktLCnaC l+ rk+g Aqcoe3G017500.1.p 53 CSECRTTKTSLWRTGPAGPKTLCNACYLRKRKMG 86 ********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 1.14E-12 | 46 | 89 | No hit | No description |
SMART | SM00401 | 6.5E-12 | 47 | 99 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 9.6E-14 | 47 | 89 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE profile | PS50114 | 11.635 | 47 | 89 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 2.39E-12 | 52 | 89 | No hit | No description |
Pfam | PF00320 | 4.3E-14 | 53 | 86 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 53 | 78 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MSDIDLNQKP LLDSDGEDDP NDFKENQKQN EGIGIGSDAE QVVVASRSSV RACSECRTTK 60 TSLWRTGPAG PKTLCNACYL RKRKMGIKKL NKQGELLDKI DAAQALVLLS KSKPNE* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A2G5CQG8 | 4e-79 | A0A2G5CQG8_AQUCA; Uncharacterized protein | ||||
STRING | Aquca_041_00158.1 | 7e-80 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56860.1 | 6e-10 | GATA family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aqcoe3G017500.1.p |